DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp313a5 and CYP4A22

DIOPT Version :9

Sequence 1:NP_650168.1 Gene:Cyp313a5 / 41486 FlyBaseID:FBgn0038005 Length:487 Species:Drosophila melanogaster
Sequence 2:NP_001010969.2 Gene:CYP4A22 / 284541 HGNCID:20575 Length:519 Species:Homo sapiens


Alignment Length:482 Identity:107/482 - (22%)
Similarity:206/482 - (42%) Gaps:50/482 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 IFEAFAIILCVYFLWSRRRFYI---MMLK----LPGPMGFPFIG--LAFEYIRLKRKIRLRTILF 61
            |.:..::::.:..|....:.|:   .:||    .|.|......|  ..|::.:..::|:.|.   
Human    18 ILQVTSLLILLLLLIKAAQLYLHRQWLLKALQQFPCPPSHWLFGHIQEFQHDQELQRIQERV--- 79

  Fly    62 KIYGKTVLTWIGLTPVLVTC-EPKILEDIFTSPNCSNRSSVVDKAISSCLGLGLLTLKNNHWNER 125
            |.:......||....|.|.. :|..::.|....:..:..|.  |.::..:|.|||.|....|.:.
Human    80 KTFPSACPYWIWGGKVRVQLYDPDYMKVILGRSDPKSHGSY--KFLAPRIGYGLLLLNGQTWFQH 142

  Fly   126 RKLLLPSFKNNAVLSFVPVLNNEANFLVTLLAEFVDGGDINL----------LPELNKWSFKIAA 180
            |::|.|:|.|:.:..:|.::.:....::....|.: |.|..|          |..:.|.:|....
Human   143 RRMLTPAFHNDILKPYVGLMADSVRVMLDKWEELL-GQDSPLEVFQHVSLMTLDTIMKSAFSHQG 206

  Fly   181 QITMGDEVRNQANYQNGNLLESYKALNNLIPIGVVMPWLRNKYLGKLFSYEKRRLEAATQSNAFI 245
            .|.:.   ||..:|     :::...||:|:...:...:..|..:..|.|..:....|...::...
Human   207 SIQVD---RNSQSY-----IQAISDLNSLVFCCMRNAFHENDTIYSLTSAGRWTHRACQLAHQHT 263

  Fly   246 KDIIDKKLSSTDNSSEPALIDR--------ILNLVRIGE---LSYDDVMGEFSNIIFAASDTLSI 299
            ..:|..:.:......|...|.|        ||.|.::..   ||..|:..|....:|...||.:.
Human   264 DQVIQLRKAQLQKEGELEKIKRKRHLDFLDILLLAKMENGSILSDKDLRAEVDTFMFEGHDTTAS 328

  Fly   300 TVNNVLILMAMFPKYQDNVFEELAEVFPSGGEFEASHADLEKLVKLDRVLHETMRLIPAVPLLIR 364
            .::.:|..:|..||:|:...||:..:...|.....:|  |:::......:.|.:||.|.||.:.|
Human   329 GISWILYALATHPKHQERCREEIHGLLGDGASITWNH--LDQMPYTTMCIKEALRLYPPVPGIGR 391

  Fly   365 QTSHSIQLSNGFYIPEGVTLMIDIFHTHRNKDIWGPQANAFNPDNFLPENKRARPPYSYLPFSKG 429
            :.|..:...:|..:|:|:.:::.|:..|.|..:| |....|:|..|.|.:  |:..:::||||.|
Human   392 ELSTPVTFPDGRSLPKGIMVLLSIYGLHHNPKVW-PNLEVFDPSRFAPGS--AQHSHAFLPFSGG 453

  Fly   430 KKTCLGWKLSLISAKLALAKILRNYML 456
            .:.|:|.:.::...|:|.|..|..:.|
Human   454 SRNCIGKQFAMNQLKVARALTLLRFEL 480

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp313a5NP_650168.1 p450 33..458 CDD:299894 102/448 (23%)
CYP4A22NP_001010969.2 p450 52..505 CDD:278495 102/448 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3B9GY
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D825914at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.