DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp313a5 and Cyp4v3

DIOPT Version :9

Sequence 1:NP_650168.1 Gene:Cyp313a5 / 41486 FlyBaseID:FBgn0038005 Length:487 Species:Drosophila melanogaster
Sequence 2:NP_001129072.1 Gene:Cyp4v3 / 266761 RGDID:708530 Length:525 Species:Rattus norvegicus


Alignment Length:517 Identity:133/517 - (25%)
Similarity:233/517 - (45%) Gaps:62/517 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 AFAIILCVYFLWSRRRFYIMMLKLPG-PMGFPFIGLAF-----------EYIRLKRKIRLRTILF 61
            |..::..:..|.|..|.:..|..:|. ...:|.:|.|.           :.|:...:.|...|  
  Rat    27 ATVLLNILQMLVSYARKWQQMRPIPSVARAYPLVGHALFMKPNNTEFFQQIIQYTEEFRHLPI-- 89

  Fly    62 KIYGKTVLTWIGLTPVLVTCEPKILEDIFTSPNCSNRSSVVDKA-----ISSCLGLGLLTLKNNH 121
                  :..|||..|::...:.:.:|.|.||      |..:||:     :...|||||||...:.
  Rat    90 ------IKLWIGPVPLVALYKAENVEVILTS------SKQIDKSFMYKFLQPWLGLGLLTSTGSK 142

  Fly   122 WNERRKLLLPSFKNNAVLSFVPVLNNEANFLVTLLAEFVDGGDINLLPELNKWSFKIAAQITMGD 186
            |..|||:|.|||....:..|:.|:|.:||.||..|.:.|:....|....:...:..|..:..||.
  Rat   143 WRARRKMLTPSFHFTILEDFLDVMNEQANILVNKLEKHVNQEAFNCFFPITLCALDIICETAMGK 207

  Fly   187 EVRNQANYQNGNLLESYKALNNLIPIGVVMPWLRNKYLGKLFSYEKRRLEAATQSNAFIKDIIDK 251
            .:..|:|..:..:...|: ::::|...:.|||........:|...:...:.....:.|..::|.:
  Rat   208 NIGAQSNGDSEYVRTVYR-MSDMIYRRMKMPWFWFDLWYLMFKEGRDHKKGLKSLHTFTNNVIAE 271

  Fly   252 KLSS---------------TDNSSEPALIDRILNLV--RIGELSYDDVMGEFSNIIFAASDTLSI 299
            ::::               ...:...|.:|.:|::.  ...:||::|:..|....:|...||.:.
  Rat   272 RVNARKAEQDCIGAGRGPLPSKTKRKAFLDLLLSVTDEEGNKLSHEDIREEVDTFMFEGHDTTAA 336

  Fly   300 TVNNVLILMAMFPKYQDNVFEELAEVFPSGGEFEASH-----ADLEKLVKLDRVLHETMRLIPAV 359
            .:|..|.|:...|:.|..|.:||.:|      |..||     .||:||..||.|:.||:|:.|:|
  Rat   337 AINWSLYLLGSNPEVQRKVDKELDDV------FGRSHRPVTLEDLKKLKYLDCVIKETLRVFPSV 395

  Fly   360 PLLIRQTSHSIQLSNGFYIPEGVTLMIDIFHTHRNKDIWGPQANAFNPDNFLPENKRARPPYSYL 424
            ||..|..|...::: |:.|.:|...:|..:..||:...: |....|.|:.|.|||.:.|.||:|:
  Rat   396 PLFARSLSEDCEVA-GYKISKGTEAVIIPYALHRDPRYF-PDPEEFQPERFFPENSQGRHPYAYV 458

  Fly   425 PFSKGKKTCLGWKLSLISAKLALAKILRNYMLSTTFLYKDLRFIDNTTMKLAEQPLLAVKRR 486
            |||.|.:.|:|.|.:::..|..||.|||.:.:.:....::|....:..::......:.:|||
  Rat   459 PFSAGPRNCIGQKFAVMEEKTILACILREFWIESNQKREELGLAGDLILRPNNGIWIKLKRR 520

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp313a5NP_650168.1 p450 33..458 CDD:299894 124/463 (27%)
Cyp4v3NP_001129072.1 CYP4V 76..515 CDD:410773 121/461 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3B9GY
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.