DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp313a5 and Cyp4f6

DIOPT Version :9

Sequence 1:NP_650168.1 Gene:Cyp313a5 / 41486 FlyBaseID:FBgn0038005 Length:487 Species:Drosophila melanogaster
Sequence 2:XP_006241111.1 Gene:Cyp4f6 / 266689 RGDID:708365 Length:538 Species:Rattus norvegicus


Alignment Length:423 Identity:108/423 - (25%)
Similarity:178/423 - (42%) Gaps:59/423 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 LTWIG-LTPVLVTCEPKILEDIFTSPNCSNRSSVVDKA------ISSCLGLGLLTLKNNHWNERR 126
            |:|:| :.|:|....|.::     :|.....::|..|.      :...||.|||......||..|
  Rat    90 LSWVGPVYPILRLVHPNVI-----APLLQASAAVAPKEMTLYGFLKPWLGDGLLMSAGEKWNHHR 149

  Fly   127 KLLLPSFKNNAVLSFVPVLNNEANFLVTLLAEFVDGGDINL----------LPELNKWSFKIAAQ 181
            :||.|:|..:.:.|:|.:.|...|.:..........|...|          |..|.|..|..   
  Rat   150 RLLTPAFHFDILKSYVKIFNKSVNTMHAKWQRLTAKGSARLDMFEHISLMTLDSLQKCIFSF--- 211

  Fly   182 ITMGDEVRNQANYQNGN------LLESYKALNNLIPIGVVMPWLRNKYLGKLFSYEKRRLEAATQ 240
                     .:|.|..|      :||    |::||......|:|...:|..|.:..:|..:|...
  Rat   212 ---------DSNCQESNSEYIAAILE----LSSLIVKRQRQPFLYLDFLYYLTADGRRFRKACDV 263

  Fly   241 SNAFIKDIIDKKLSSTDNSSEPALI-----DRILNLVRIGELSYD---------DVMGEFSNIIF 291
            .:.|...:|.::.|:.:.......:     .:.|:.:.:..|:.|         |:..|....:|
  Rat   264 VHNFTDAVIRERRSTLNTQGVDEFLKARAKTKTLDFIDVLLLAKDEHGKGLSDVDIRAEADTFMF 328

  Fly   292 AASDTLSITVNNVLILMAMFPKYQDNVFEELAEVFPSGGEFEASHADLEKLVKLDRVLHETMRLI 356
            ...||.:..::.:|..:|..|:||:...:|:.|:.......|....||.:|..|...:.|::||.
  Rat   329 GGHDTTASALSWILYNLARHPEYQERCRQEVRELLRDREPEEIEWDDLAQLPFLTMCIKESLRLH 393

  Fly   357 PAVPLLIRQTSHSIQLSNGFYIPEGVTLMIDIFHTHRNKDIWGPQANAFNPDNFLPENKRARPPY 421
            |.|.|:.|..|..|.|.:|..||:|...:|.||..|.|..:| |....:||..|.|||.:.|.|.
  Rat   394 PPVLLISRCCSQDIVLPDGRVIPKGNICVISIFGVHHNPSVW-PDPEVYNPFRFDPENPQKRSPL 457

  Fly   422 SYLPFSKGKKTCLGWKLSLISAKLALAKILRNY 454
            :::|||.|.:.|:|...::...|:|||..|..:
  Rat   458 AFIPFSAGPRNCIGQTFAMSEIKVALALTLLRF 490

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp313a5NP_650168.1 p450 33..458 CDD:299894 108/423 (26%)
Cyp4f6XP_006241111.1 p450 53..515 CDD:278495 108/423 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3B9GY
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.