DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp313a5 and Cyp4a2

DIOPT Version :9

Sequence 1:NP_650168.1 Gene:Cyp313a5 / 41486 FlyBaseID:FBgn0038005 Length:487 Species:Drosophila melanogaster
Sequence 2:XP_038965182.1 Gene:Cyp4a2 / 24306 RGDID:2479 Length:517 Species:Rattus norvegicus


Alignment Length:450 Identity:102/450 - (22%)
Similarity:184/450 - (40%) Gaps:95/450 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 VLTWI------------GLTPVLVTCEPKILEDIFTSPNCSNRSSVVD-KAISSCLGLGLLTLKN 119
            ||||:            |.|..::..:|..::.:.      .||.... ::::..:|.|||.|..
  Rat    72 VLTWVEKFPGACLQWLSGSTARVLLYDPDYVKVVL------GRSDPKPYQSLAPWIGYGLLLLNG 130

  Fly   120 NHWNERRKLLLPSFKNNAVLSFVPVLNNEANFLVTLLAEFVDGGDINLLPELNKWS--------- 175
            ..|.:.|::|.|:|..:.:..:|.::.:..:.:                  |:||.         
  Rat   131 KKWFQHRRMLTPAFHYDILKPYVKIMADSVSIM------------------LDKWEKLDDQDHPL 177

  Fly   176 --FKIAAQITMGDEVRNQANYQNGNLLE----SY-KA---LNNLIPIGVVMPWLRNKYLGKLFSY 230
              |...:.:|:...::...::|....|:    || ||   |||||...|     |:.:.|....|
  Rat   178 EIFHYVSLMTLDTVMKCAFSHQGSVQLDVNSRSYTKAVEDLNNLIFFRV-----RSAFYGNSIIY 237

  Fly   231 --------EKRRLEAATQSN-------AFIK---DIIDKKLSSTDNSSE--PALIDRILNLVRI- 274
                    .:|..:.|.:..       ||:.   .:|..:.:...|..|  .|...|.|:.:.| 
  Rat   238 NMSSDGRLSRRACQIAHEHTGSVFLLPAFLSLSDGVIKTRKAQLQNEEELQKARKKRHLDFLDIL 302

  Fly   275 --------GELSYDDVMGEFSNIIFAASDTLSITVNNVLILMAMFPKYQDNVFEELAEVFPSGGE 331
                    ..||.:|:..|....:|...||.:..::.|...:|..|::|:...||:..:...|..
  Rat   303 LFAKMEDGKSLSDEDLRAEVDTFMFEGHDTTASGISWVFYALATHPEHQERCREEVQSILGDGTS 367

  Fly   332 FEASHADLEKLVKLDRVLHETMRLIPAVPLLIRQTSHSIQLSNGFYIPEGVTLMIDIFHTHRNKD 396
            ....|  |:::......:.|.:||...||.:.|:.|..:...:|..||:|:.:.|.|:..|.|..
  Rat   368 VTWDH--LDQMPYTTMCIKEALRLYSPVPSVSRELSSPVTFPDGRSIPKGIRVTILIYGLHHNPS 430

  Fly   397 IWGPQANAFNPDNFLPENKRARPPYSYLPFSKGKKTCLGWKLSLISAKLALAKILRNYML 456
            .| |....|:|..|.|::  .|..::|||||.|.:.|:|.:.::...|:|:|..|..:.|
  Rat   431 YW-PNPKVFDPSRFSPDS--PRHSHAYLPFSGGARNCIGKQFAMNELKVAVALTLLRFEL 487

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp313a5NP_650168.1 p450 33..458 CDD:299894 101/449 (22%)
Cyp4a2XP_038965182.1 CYP4B-like 69..512 CDD:410771 101/449 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3B9GY
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.