DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp313a5 and CYP4Z1

DIOPT Version :9

Sequence 1:NP_650168.1 Gene:Cyp313a5 / 41486 FlyBaseID:FBgn0038005 Length:487 Species:Drosophila melanogaster
Sequence 2:NP_835235.1 Gene:CYP4Z1 / 199974 HGNCID:20583 Length:505 Species:Homo sapiens


Alignment Length:506 Identity:128/506 - (25%)
Similarity:210/506 - (41%) Gaps:107/506 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 IILC-------VYFLWSRRRFYIMMLKL-PGPMGFPFIGLAFEYIRLKRKIRLRTILFKIYGK-- 66
            |:||       |..|:.|||:.|..|.| |.|....|.|.. |:..:|.        |::|.|  
Human    18 ILLCMSLLLFQVIRLYQRRRWMIRALHLFPAPPAHWFYGHK-EFYPVKE--------FEVYHKLM 73

  Fly    67 -----TVLTWIG-LTPVLVTCEP---KIL---EDIFTSPNCSNRSSVVDKAISSCLGLGLLTLKN 119
                 .|..|:| .|......:|   |||   :|        .:|:|..|.:.|.:|.||:||..
Human    74 EKYPCAVPLWVGPFTMFFSVHDPDYAKILLKRQD--------PKSAVSHKILESWVGRGLVTLDG 130

  Fly   120 NHWNERRKLLLPSFKNNAVLSFVPVLNNEANFLVTLLAEFVDGGDINLLPELNKWS--------- 175
            :.|.:.|:::.|.|..:.:..|:.:::.....:                  ||||.         
Human   131 SKWKKHRQIVKPGFNISILKIFITMMSESVRMM------------------LNKWEEHIAQNSRL 177

  Fly   176 --FKIAAQITMGDEVR----NQANYQNGNLLESY-KALNNLIPIGVVMPWLRNKYL--------- 224
              |:..:.:|:...::    :|.:.|..:.|:|| ||:.||..|.   ....|.:|         
Human   178 ELFQHVSLMTLDSIMKCAFSHQGSIQLDSTLDSYLKAVFNLSKIS---NQRMNNFLHHNDLVFKF 239

  Fly   225 ---GKLFSYEKRRLEAATQSNAFIKDIIDKKLSSTDNSSEPALIDRILNLVRI---------GEL 277
               |::||...:.|...|:     |.|.|:|.|..|...:.....|..:.:.|         .:.
Human   240 SSQGQIFSKFNQELHQFTE-----KVIQDRKESLKDKLKQDTTQKRRWDFLDILLSAKSENTKDF 299

  Fly   278 SYDDVMGEFSNIIFAASDTLSITVNNVLILMAMFPKYQDNVFEELAEVFPSGGEFEASHADLEKL 342
            |..|:..|....:||..||.|..::.:|..:|.:|::|....:|:.|:...|......|  |.::
Human   300 SEADLQAEVKTFMFAGHDTTSSAISWILYCLAKYPEHQQRCRDEIRELLGDGSSITWEH--LSQM 362

  Fly   343 VKLDRVLHETMRLIPAVPLLIRQTSHSIQLSNGFYIPEGVTLMIDIFHTHRNKDIW-GPQANAFN 406
            ......:.|.:||...|..:.|.....|...:|..:|.|:|:.|:|:..|.|...| .||  .||
Human   363 PYTTMCIKECLRLYAPVVNISRLLDKPITFPDGRSLPAGITVFINIWALHHNPYFWEDPQ--VFN 425

  Fly   407 PDNFLPENKRARPPYSYLPFSKGKKTCLGWKLSLISAKLALAKILRNYMLS 457
            |..|..||.....||:::|||.|.:.|:|...::|..|:|:|..|..:.|:
Human   426 PLRFSRENSEKIHPYAFIPFSAGLRNCIGQHFAIIECKVAVALTLLRFKLA 476

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp313a5NP_650168.1 p450 33..458 CDD:299894 117/477 (25%)
CYP4Z1NP_835235.1 p450 47..500 CDD:278495 117/477 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D825914at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.