DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp313a5 and CYP4B1

DIOPT Version :9

Sequence 1:NP_650168.1 Gene:Cyp313a5 / 41486 FlyBaseID:FBgn0038005 Length:487 Species:Drosophila melanogaster
Sequence 2:NP_001093242.1 Gene:CYP4B1 / 1580 HGNCID:2644 Length:512 Species:Homo sapiens


Alignment Length:469 Identity:108/469 - (23%)
Similarity:194/469 - (41%) Gaps:47/469 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 VYFLWSRRRFYIMMLKLPGPMGFPFIGLAFEYIRLKRKIRLRTILFKIYGKTVLTWIGLTP---- 76
            ::.|..|:.....|.|.|||......|.|.|       |:....|.|     |::|....|    
Human    30 IHLLLRRQTLAKAMDKFPGPPTHWLFGHALE-------IQETGSLDK-----VVSWAHQFPYAHP 82

  Fly    77 --------VLVTCEPKILEDIFT--SPNCSNRSSVVDKAISSCLGLGLLTLKNNHWNERRKLLLP 131
                    .|...||...:.:::  .|...:   |.|..: ..:|.|||.|:...|.:.||||.|
Human    83 LWFGQFIGFLNIYEPDYAKAVYSRGDPKAPD---VYDFFL-QWIGRGLLVLEGPKWLQHRKLLTP 143

  Fly   132 SFKNNAVLSFVPVLNNEANFLVTLLAEFV-DGGDINLLPELNKWSFKIAAQITMGDEVRNQANYQ 195
            .|..:.:..:|.|.......::....|.. :|...::..::...:.....:.|.|.......:.:
Human   144 GFHYDVLKPYVAVFTESTRIMLDKWEEKAREGKSFDIFCDVGHMALNTLMKCTFGRGDTGLGHSR 208

  Fly   196 NGNLLESYKALNNLIPIGVVMPWLRNKYLGKLFSYEKRRLEAATQSNAFIKDII-DKKLSSTDNS 259
            :.:...:...|..|:...:|.....|.::..|..:.:|.|.|...::.....:| ::|.:..|..
Human   209 DSSYYLAVSDLTLLMQQRLVSFQYHNDFIYWLTPHGRRFLRACQVAHDHTDQVIRERKAALQDEK 273

  Fly   260 SEPALIDR----ILNLVRIG-------ELSYDDVMGEFSNIIFAASDTLSITVNNVLILMAMFPK 313
            ....:.:|    .|::: :|       :||..|:..|....:|...||.:..::..|..||::|:
Human   274 VRKKIQNRRHLDFLDIL-LGARDEDDIKLSDADLRAEVDTFMFEGHDTTTSGISWFLYCMALYPE 337

  Fly   314 YQDNVFEELAEVFPSGGEFEASHADLEKLVKLDRVLHETMRLIPAVPLLIRQTSHSIQLSNGFYI 378
            :|....||:.|:......|:..  ||.|:..|...:.|:.||.|.||.:.||.|..:...:|..:
Human   338 HQHRCREEVREILGDQDFFQWD--DLGKMTYLTMCIKESFRLYPPVPQVYRQLSKPVTFVDGRSL 400

  Fly   379 PEGVTLMIDIFHTHRNKDIWGPQANAFNPDNFLPENKRARPPYSYLPFSKGKKTCLGWKLSLISA 443
            |.|..:.:.|:..|||..:| |....|:...|..||...|.|::::|||.|.:.|:|.:.::...
Human   401 PAGSLISMHIYALHRNSAVW-PDPEVFDSLRFSTENASKRHPFAFMPFSAGPRNCIGQQFAMSEM 464

  Fly   444 KLALAKILRNYMLS 457
            |:..|..|..:..|
Human   465 KVVTAMCLLRFEFS 478

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp313a5NP_650168.1 p450 33..458 CDD:299894 104/452 (23%)
CYP4B1NP_001093242.1 p450 47..501 CDD:306555 104/452 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3B9GY
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.