DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp313a5 and CYP4A11

DIOPT Version :9

Sequence 1:NP_650168.1 Gene:Cyp313a5 / 41486 FlyBaseID:FBgn0038005 Length:487 Species:Drosophila melanogaster
Sequence 2:NP_000769.2 Gene:CYP4A11 / 1579 HGNCID:2642 Length:519 Species:Homo sapiens


Alignment Length:368 Identity:88/368 - (23%)
Similarity:163/368 - (44%) Gaps:35/368 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   110 LGLGLLTLKNNHWNERRKLLLPSFKNNAVLSFVPVLNNEANFLVTLLAEFVDGGDINL------- 167
            :|.|||.|....|.:.|::|.|:|..:.:..:|.::.:....::....|.: |.|..|       
Human   127 IGYGLLLLNGQTWFQHRRMLTPAFHYDILKPYVGLMADSVRVMLDKWEELL-GQDSPLEVFQHVS 190

  Fly   168 ---LPELNKWSFKIAAQITMGDEVRNQANYQNGNLLESYKALNNLIPIGVVMPWLRNKYLGKLFS 229
               |..:.|.:|.....|.:.   ||..:|     :::...||||:...|...:.:|..:..|.|
Human   191 LMTLDTIMKCAFSHQGSIQVD---RNSQSY-----IQAISDLNNLVFSRVRNAFHQNDTIYSLTS 247

  Fly   230 YEKRRLEAATQSNAFIKDIIDKKLSSTDNSSEPALIDR--------ILNLVRIGE---LSYDDVM 283
            ..:....|...::.....:|..:.:......|...|.|        ||.|.::..   ||..|:.
Human   248 AGRWTHRACQLAHQHTDQVIQLRKAQLQKEGELEKIKRKRHLDFLDILLLAKMENGSILSDKDLR 312

  Fly   284 GEFSNIIFAASDTLSITVNNVLILMAMFPKYQDNVFEELAEVFPSGGEFEASHADLEKLVKLDRV 348
            .|....:|...||.:..::.:|..:|..||:|:...||:..:...|.....:|  |:::......
Human   313 AEVDTFMFEGHDTTASGISWILYALATHPKHQERCREEIHSLLGDGASITWNH--LDQMPYTTMC 375

  Fly   349 LHETMRLIPAVPLLIRQTSHSIQLSNGFYIPEGVTLMIDIFHTHRNKDIWGPQANAFNPDNFLPE 413
            :.|.:||.|.||.:.|:.|..:...:|..:|:|:.:::.|:..|.|..:| |....|:|..|.|.
Human   376 IKEALRLYPPVPGIGRELSTPVTFPDGRSLPKGIMVLLSIYGLHHNPKVW-PNPEVFDPFRFAPG 439

  Fly   414 NKRARPPYSYLPFSKGKKTCLGWKLSLISAKLALAKILRNYML 456
            :  |:..:::||||.|.:.|:|.:.::...|:|.|..|..:.|
Human   440 S--AQHSHAFLPFSGGSRNCIGKQFAMNELKVATALTLLRFEL 480

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp313a5NP_650168.1 p450 33..458 CDD:299894 88/368 (24%)
CYP4A11NP_000769.2 p450 52..505 CDD:278495 88/368 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3B9GY
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.