DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp313a5 and cyp-31A5

DIOPT Version :9

Sequence 1:NP_650168.1 Gene:Cyp313a5 / 41486 FlyBaseID:FBgn0038005 Length:487 Species:Drosophila melanogaster
Sequence 2:NP_001343697.1 Gene:cyp-31A5 / 13198891 WormBaseID:WBGene00013381 Length:308 Species:Caenorhabditis elegans


Alignment Length:234 Identity:51/234 - (21%)
Similarity:98/234 - (41%) Gaps:20/234 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 MLKLPGPMGF--PFIGLAFEYIRLKRKIRLRTILFKIYGKTVLTWIGLTPVLVTCEPKILEDIFT 91
            ::..|.|.||  ..||:.:.|..               .:..|.|||..|.|:.....::|.||:
 Worm    46 LITKPDPEGFMNQVIGMGYLYPD---------------PRMCLLWIGPFPCLMLYSADLVEPIFS 95

  Fly    92 SPNCSNRSSVVDKAISSCLGLGLLTLKNNHWNERRKLLLPSFKNNAVLSFVPVLNNEANFLVTLL 156
            |....|:.... ..:...||:.:||.:...|..:||||.|:|..:.:..|:|:.|.::..|:..|
 Worm    96 STKHLNKGFAY-VLLEPWLGISILTSQKEQWRPKRKLLTPTFHYDILKDFLPIFNEQSKILIQKL 159

  Fly   157 AEF-VDGGDINLLPELNKWSFKIAAQITMGDEVRNQANYQNGNLLESYKALNNLIPIGVVMPWLR 220
            ... |...::::|..:...:..|..:.:||..:..|. .:|...:.:...:|.||......|.:.
 Worm   160 CCLGVADEEVDVLSVITLCTLDIICETSMGKAIGAQL-AENNEYVWAVHTINKLISKRTNNPLMW 223

  Fly   221 NKYLGKLFSYEKRRLEAATQSNAFIKDIIDKKLSSTDNS 259
            |.::..|....:...:.....:.|.|.:|.::..:..:|
 Worm   224 NSFIYNLTEDGRTHEKCLHILHDFTKKVIVERKEALQDS 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp313a5NP_650168.1 p450 33..458 CDD:299894 51/230 (22%)
cyp-31A5NP_001343697.1 p450 36..>261 CDD:325183 50/231 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.