DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp313a5 and Cyp4b1

DIOPT Version :9

Sequence 1:NP_650168.1 Gene:Cyp313a5 / 41486 FlyBaseID:FBgn0038005 Length:487 Species:Drosophila melanogaster
Sequence 2:NP_031849.1 Gene:Cyp4b1 / 13120 MGIID:103225 Length:511 Species:Mus musculus


Alignment Length:501 Identity:116/501 - (23%)
Similarity:200/501 - (39%) Gaps:92/501 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 AFAIILCV------YFLWSRRRFYIMMLKLPGPMGFPFIGLAFEYIRLKRKIRLRTILFKIYG-K 66
            |..:||.|      ..|:.|::....:...|||......|.|.|             :.|..| .
Mouse    17 ASVVILMVTVLKLLSLLFRRQKLARALDSFPGPPKHWLFGHALE-------------IQKTGGLD 68

  Fly    67 TVLTWIGLTP------------VLVTCEPKILEDIFTSPNCSNRSSVVDKAISSCLGLGLLTLKN 119
            .|:||....|            .|...||...:.:::..:  .:::.|.......:|.|||.|:.
Mouse    69 KVVTWTEQFPYAHPLWLGQFIVFLNIYEPDYAKAVYSRGD--PKAAYVYDFFLQWIGKGLLVLEG 131

  Fly   120 NHWNERRKLLLPSFKNNAVLSFVPVLNNEANFLVTLLAEFVDGGDINLLPELNKW--------SF 176
            ..|.:.||||.|.|..:.:..:|.:.......:                  |:||        ||
Mouse   132 PKWFQHRKLLTPGFHYDVLKPYVAIFAESTRVM------------------LDKWEKKASENKSF 178

  Fly   177 KIAAQI-TMGDEVRNQANYQNGN--LLES----YKALNNLIPIGVVMP------WLRNKYLGKLF 228
            .|...: .|..:...:..:..|:  |..|    |.|:::|.   ::|.      ...|.::..|.
Mouse   179 DIFCDVGHMALDTLMKCTFGKGDSGLSHSDNSYYLAVSDLT---LLMQQRIDSFQYHNDFIYWLT 240

  Fly   229 SYEKRRLEAATQSNAFIKDII-DKKLSSTDNSSEPALIDR----ILNLVRIG-------ELSYDD 281
            .:.:|.|.|...::.....:| .:|.:..|...:..|.:|    .|::: :|       :||..|
Mouse   241 PHGRRFLRACQIAHDHTDHVIRQRKAALQDEKEQKKLQERRHLDFLDIL-LGARDESGIKLSDAD 304

  Fly   282 VMGEFSNIIFAASDTLSITVNNVLILMAMFPKYQDNVFEELAEVFPSGGEFEASHADLEKLVKLD 346
            :..|....:|...||.:..::..|..||::|.:|....||:.|:......|:..  ||.::..|.
Mouse   305 LRAEVDTFMFEGHDTTTSGISWFLYCMALYPMHQQRCREEVREILGDRDSFQWD--DLAQMTYLT 367

  Fly   347 RVLHETMRLIPAVPLLIRQTSHSIQLSNGFYIPEGVTLMIDIFHTHRNKDIWGPQANAFNPDNFL 411
            ..:.|..||.|.||.:.||.|..:...:|..:|.|..:.:.|:..|||..:| |....|:|..|.
Mouse   368 MCMKECFRLYPPVPQVYRQLSKPVTFVDGRSLPAGSLISLHIYALHRNSAVW-PDPEVFDPLRFS 431

  Fly   412 PENKRARPPYSYLPFSKGKKTCLGWKLSLISAKLALAKILRNYMLS 457
            |||...|.|::::|||.|.:.|:|.:.::...|:..|..|..:..|
Mouse   432 PENMTGRHPFAFMPFSAGPRNCIGQQFAMNEMKVVTALCLLRFEFS 477

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp313a5NP_650168.1 p450 33..458 CDD:299894 110/471 (23%)
Cyp4b1NP_031849.1 p450 47..500 CDD:278495 110/471 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3B9GY
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.