DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp313a5 and Cyp4a12b

DIOPT Version :9

Sequence 1:NP_650168.1 Gene:Cyp313a5 / 41486 FlyBaseID:FBgn0038005 Length:487 Species:Drosophila melanogaster
Sequence 2:NP_758510.2 Gene:Cyp4a12b / 13118 MGIID:3611747 Length:508 Species:Mus musculus


Alignment Length:485 Identity:101/485 - (20%)
Similarity:200/485 - (41%) Gaps:85/485 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 FIGLAFEYIRLKRKIRLRTILFK-----IYGKTVLT-----------WIGLTPVLVTCEPKILED 88
            |.|...||:::...:.|..:|||     ::.:.:|:           |:....:|   :.:.|:|
Mouse    11 FPGSISEYLQVASVLSLLLLLFKTAQLYLHRQWLLSSTQQFPSPPSHWLFGHKIL---KDQDLQD 72

  Fly    89 IFTS----PN-CSN-------RSSVVD-------------------KAISSCLGLGLLTLKNNHW 122
            |.|.    |: |..       |..|.|                   :.::..:|.|||.|....|
Mouse    73 ILTRIKNFPSACPQWLWGSKVRIQVYDPDYMKLILGRSDPKAHGSYRFLAPWIGRGLLLLDGQTW 137

  Fly   123 NERRKLLLPSFKNNAVLSFVPVLNNEANFLVTLLAEFVDGGDINL----------LPELNKWSFK 177
            .:.|::|.|:|..:.:..:..::.:..:.::....:.| |.|..|          |..:.|.:|.
Mouse   138 FQHRRMLTPAFHYDILKPYTEIMADSVHVMLDKWEQIV-GQDSTLEIFQHITLMTLDTIMKCAFS 201

  Fly   178 IAAQITMGDEVRNQANYQNGNLLESYKALNNLIPIGVVMPWLRNKYLGKLFSYEKRRLEAATQSN 242
            ....:.:.   |...:|     :::.:.||||..:.|...:.:|..:.::.|.......|...::
Mouse   202 HEGSVQLD---RKYKSY-----IQAVEDLNNLFFLRVRNIFHQNDIIYRVSSNGCLANSACQLAH 258

  Fly   243 AFIKDIIDKKLSSTDNSSEPALIDR--------ILNLVRI---GELSYDDVMGEFSNIIFAASDT 296
            .....:|..:.|...:..|...:.:        ||...|:   ..||..|:..|....:|...||
Mouse   259 DHTDQVIKSRRSQLQDEEELEKLKKKRRLDFLDILLFARMENGKSLSDKDLRAEVDTFMFEGHDT 323

  Fly   297 LSITVNNVLILMAMFPKYQDNVFEELAEVFPSGGEFEASHADLEKLVKLDRVLHETMRLIPAVPL 361
            .:..::.:...:|..|::|....:|:..:...|...  :..||:|:......:.|.:|:.|.||.
Mouse   324 TASGISWIFYALATNPEHQQRCRKEIQSLLGDGASI--TWNDLDKMPYTTMCIKEALRIYPPVPS 386

  Fly   362 LIRQTSHSIQLSNGFYIPEGVTLMIDIFHTHRNKDIWGPQANAFNPDNFLPENKRARPPYSYLPF 426
            :.|:.|..:...:|..:|:|:.:|:..:..|.|..:| |....|:|..|.|.:  :|..:|:|||
Mouse   387 VSRELSSPVTFPDGRSLPKGIHVMLSFYGLHHNPTVW-PNPEVFDPSRFAPGS--SRHSHSFLPF 448

  Fly   427 SKGKKTCLGWKLSLISAKLALAKILRNYML 456
            |.|.:.|:|.:.::...|:|:|..|..:.|
Mouse   449 SGGARNCIGKQFAMNELKVAVALTLLRFEL 478

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp313a5NP_650168.1 p450 33..458 CDD:299894 101/485 (21%)
Cyp4a12bNP_758510.2 CYP4B-like 70..503 CDD:410771 90/423 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3B9GY
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.