DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp313a5 and CYP46A1

DIOPT Version :9

Sequence 1:NP_650168.1 Gene:Cyp313a5 / 41486 FlyBaseID:FBgn0038005 Length:487 Species:Drosophila melanogaster
Sequence 2:NP_006659.1 Gene:CYP46A1 / 10858 HGNCID:2641 Length:500 Species:Homo sapiens


Alignment Length:511 Identity:120/511 - (23%)
Similarity:219/511 - (42%) Gaps:71/511 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLTLQIFEAFAIILCVYFLWSRRRFYIMMLKLPGPMGFPFIGLAFEYIRLKRKIRLRTI--LF-- 61
            :|...:..||.  ||..|:...|..|   ..:|||....|:.........|.::..|.:  :|  
Human     7 LLGSAVLLAFG--LCCTFVHRARSRY---EHIPGPPRPSFLLGHLPCFWKKDEVGGRVLQDVFLD 66

  Fly    62 --KIYGKTV-LTWIGLTPVLVTCEPKILEDIFTSPNCSNRSSVVDKAISS-----CLGLGLLTLK 118
              |.||..| :.....|.|:|| .|:.::....|.. .|:.|.:.:|:.:     ..|.||::..
Human    67 WAKKYGPVVRVNVFHKTSVIVT-SPESVKKFLMSTK-YNKDSKMYRALQTVFGERLFGQGLVSEC 129

  Fly   119 N-NHWNERRKLLLPSFKNNAVLSFVPVLNNEANFLVTLLAEFVDG-GDINLLPELNKWSFKIAAQ 181
            | ..|:::|:::..:|..::::|.:...|.:|..||.:|....|| ..:::...|...:..|.|:
Human   130 NYERWHKQRRVIDLAFSRSSLVSLMETFNEKAEQLVEILEAKADGQTPVSMQDMLTYTAMDILAK 194

  Fly   182 ITMGDEVRNQANYQNGNLLESYKALNNLIPI---GVVMPWLRNKYLGKLFSYEKRRLEAATQSNA 243
            ...|.|        ...||.:.|.|:..:.:   |:...  ||. |.|....::::|....:|..
Human   195 AAFGME--------TSMLLGAQKPLSQAVKLMLEGITAS--RNT-LAKFLPGKRKQLREVRESIR 248

  Fly   244 FI----KDIIDKKLSSTDNSSE-PALIDRILNLVRIGELSYDD--VMGEFSNIIFAASDTLSITV 301
            |:    :|.:.::..:.....| ||  |.:..:::..|.:.||  ::..|.....|..:|.:..:
Human   249 FLRQVGRDWVQRRREALKRGEEVPA--DILTQILKAEEGAQDDEGLLDNFVTFFIAGHETSANHL 311

  Fly   302 NNVLILMAMFPKYQDNVFEELAEVFPSGG--EFEASHADLEKLVKLDRVLHETMRLIP----AVP 360
            ...::.::..|:....:..|:.||..|..  :||    ||.:|..|.:||.|::||.|    ...
Human   312 AFTVMELSRQPEIVARLQAEVDEVIGSKRYLDFE----DLGRLQYLSQVLKESLRLYPPAWGTFR 372

  Fly   361 LLIRQTSHSIQLSNGFYIPEGVTLMIDIFHTHRNKDIWGPQANAFNPDNFLPENKRARPPYSYLP 425
            ||..:|     |.:|..:|....|:...:...| .|.:......||||.|.|  ...:|.::|.|
Human   373 LLEEET-----LIDGVRVPGNTPLLFSTYVMGR-MDTYFEDPLTFNPDRFGP--GAPKPRFTYFP 429

  Fly   426 FSKGKKTCLGWKLSLISAKLALAKILRNYMLSTTFLYKDLRFIDNTTMKLAEQPLL 481
            ||.|.::|:|.:.:.:..|:.:||:|:..         :.|.:......|.||..|
Human   430 FSLGHRSCIGQQFAQMEVKVVMAKLLQRL---------EFRLVPGQRFGLQEQATL 476

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp313a5NP_650168.1 p450 33..458 CDD:299894 107/454 (24%)
CYP46A1NP_006659.1 p450 34..466 CDD:365848 108/467 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D825914at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.