DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp313a5 and XB980013

DIOPT Version :9

Sequence 1:NP_650168.1 Gene:Cyp313a5 / 41486 FlyBaseID:FBgn0038005 Length:487 Species:Drosophila melanogaster
Sequence 2:XP_002931492.1 Gene:XB980013 / 100487918 XenbaseID:XB-GENE-980014 Length:516 Species:Xenopus tropicalis


Alignment Length:491 Identity:115/491 - (23%)
Similarity:200/491 - (40%) Gaps:65/491 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 FEAFAIILCVYFL----------WSRRRFYIMMLKLPGPMGFPFIGLAFEYIRLKRKIRLRTILF 61
            |..||.:||:..|          |...:..:.  ..|||......|.|.:: |.......|.:|:
 Frog    21 FGQFAALLCLILLLLKACGLFIRWKSLKDALQ--NFPGPPKHWLYGNANQF-RNDGTDMDRILLW 82

  Fly    62 -KIYGKTVLTWIG-LTPVLVTCEPKILEDIFTSPNCSNRSSVVDKAISSCLGLGLLTLKNNHWNE 124
             ..|.|....|:| ....||...|:..:..|...:....:..  ..:...:|.|||.|..:.|.:
 Frog    83 ANKYPKAFPLWVGQFFASLVITNPEYAKAAFARSDPKTPTGY--DFLIPWIGKGLLVLSGDTWFQ 145

  Fly   125 RRKLLLPSFKNNAVLSFVPVLNNEANFLVTLLAEFVDGGD---------INLLPELNKWSFKIAA 180
            .|:||.|.|..:.:..:..::::....::.....|.:.|:         :..|..:.|.:|...:
 Frog   146 HRRLLTPGFHYDVLKPYAKLISDSTKVMLDKWVPFSNKGEPVELFHHVSLMTLDSIMKCAFSYHS 210

  Fly   181 QI-TMGDEVRNQA----NYQNGNLLESYKALNNLI----PIGVVMP---WLRNKYLGKLFSYEKR 233
            .. |..|....:|    :|...:...::...||||    |.|.:..   .:.:::..|:....|.
 Frog   211 NCQTDNDNSYTKAVYDLSYLTHHRARTFPYHNNLIYYLSPHGFLFRKACRIAHQHTDKVIKQRKT 275

  Fly   234 RLEAATQSNAFIK-------DIIDKKLSSTDNSSEPALIDRILNLVRIGELSYDDVMGEFSNIIF 291
            .|:   ....|.|       |.:|..|.:.|.:.:              .||.:|:..|....:|
 Frog   276 LLQ---NKEEFEKVKQKRHPDFLDILLCARDENGK--------------GLSDEDLRAEVDTFMF 323

  Fly   292 AASDTLSITVNNVLILMAMFPKYQDNVFEELAEVFPSGGEFEASHADLEKLVKLDRVLHETMRLI 356
            ...||.:..::.:|..||.:|::|....||:.:|......||  ..||.|:......:.|::||.
 Frog   324 EGHDTTASGISWILYCMAKYPEHQQKCREEIRDVLGEKESFE--WEDLNKIPYTTMCIKESLRLY 386

  Fly   357 PAVPLLIRQTSHSIQLSNGFYIPEGVTLMIDIFHTHRNKDIWGPQANAFNPDNFLPENKRARPPY 421
            |.||.:.|:.:..|..|:|..:|.|..:.|:||..|||..:| .....|:|..|..||...|..:
 Frog   387 PPVPAVSRELNKPITFSDGRSLPAGSVIFINIFCIHRNPTVW-KDPEVFDPLRFSSENSSKRHSH 450

  Fly   422 SYLPFSKGKKTCLGWKLSLISAKLALAKILRNYMLS 457
            :::||:.|.:.|:|...::...|:|:|..|..|.||
 Frog   451 AFVPFAAGPRNCIGQNFAMNELKVAVALTLNRYELS 486

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp313a5NP_650168.1 p450 33..458 CDD:299894 108/455 (24%)
XB980013XP_002931492.1 p450 55..508 CDD:278495 108/455 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.