DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3916 and TMPRSS15

DIOPT Version :10

Sequence 1:NP_650167.1 Gene:CG3916 / 41484 FlyBaseID:FBgn0038003 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_001414985.1 Gene:TMPRSS15 / 5651 HGNCID:9490 Length:1064 Species:Homo sapiens


Alignment Length:90 Identity:17/90 - (18%)
Similarity:30/90 - (33%) Gaps:26/90 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 LTKRELKTLKNALGKQGLTMEQHENAQKSTKPCEILQIDTFSIDNSNLEDGWYVGYGVEYNGVGI 81
            |..:.|:..::||..|.   ::.|...:..:.|.:.|.                   ::..|   
Human   266 LVSQALEAAEHALQAQA---QELEELNRELRQCNLQQF-------------------IQQTG--- 305

  Fly    82 SAAGGAPDSSASSESGDLPPAENRE 106
             ||...|.....:.:.||||....|
Human   306 -AALPPPPQLDRTSTQDLPPPTREE 329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3916NP_650167.1 Tryp_SPc 30..257 CDD:214473 13/77 (17%)
TMPRSS15NP_001414985.1 None

Return to query results.
Submit another query.