DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3916 and CG11912

DIOPT Version :10

Sequence 1:NP_650167.1 Gene:CG3916 / 41484 FlyBaseID:FBgn0038003 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_608517.1 Gene:CG11912 / 33205 FlyBaseID:FBgn0031248 Length:271 Species:Drosophila melanogaster


Alignment Length:37 Identity:10/37 - (27%)
Similarity:15/37 - (40%) Gaps:17/37 - (45%)


- Green bases have known domain annotations that are detailed below.


  Fly   177 FKTGEFVTTQRFGVATTTTKCSETDDEFPQGYQIIGD 213
            :..|:|         .:|||.:|:        |||.|
  Fly    18 YSVGDF---------NSTTKLAES--------QIISD 37

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3916NP_650167.1 Tryp_SPc 30..257 CDD:214473 10/37 (27%)
CG11912NP_608517.1 Tryp_SPc 29..264 CDD:214473 5/17 (29%)

Return to query results.
Submit another query.