DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3916 and CG32260

DIOPT Version :10

Sequence 1:NP_650167.1 Gene:CG3916 / 41484 FlyBaseID:FBgn0038003 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_728942.1 Gene:CG32260 / 317943 FlyBaseID:FBgn0052260 Length:575 Species:Drosophila melanogaster


Alignment Length:52 Identity:11/52 - (21%)
Similarity:19/52 - (36%) Gaps:20/52 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   265 ISEEKSMTIP--------------------LDGDKLAQISAAMANFQLPTPP 296
            |.|:.::.||                    :.|..|:.::....:|.|.|||
  Fly    47 IEEQGAVLIPGVYDALSAAIVQQTGFSAALISGYALSAVTLGKPDFGLITPP 98

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3916NP_650167.1 Tryp_SPc 30..257 CDD:214473
CG32260NP_728942.1 CLIP 194..244 CDD:463440
Tryp_SPc 328..571 CDD:238113
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.