DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3916 and St14

DIOPT Version :10

Sequence 1:NP_650167.1 Gene:CG3916 / 41484 FlyBaseID:FBgn0038003 Length:267 Species:Drosophila melanogaster
Sequence 2:XP_036010597.1 Gene:St14 / 19143 MGIID:1338881 Length:875 Species:Mus musculus


Alignment Length:261 Identity:77/261 - (29%)
Similarity:121/261 - (46%) Gaps:50/261 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 RINGGQRVNE-TVPFQVSLQMQRRGRWQHFCGGSIVSGQHVLTAAHCME---KMKVEDVSV---V 87
            |:.||...:| ..|:||||....:|   |.||.|::|...:::||||.:   ..|..|.::   .
Mouse   634 RVVGGTNADEGEWPWQVSLHALGQG---HLCGASLISPDWLVSAAHCFQDDKNFKYSDYTMWTAF 695

  Fly    88 VGTLNW---KAGGLRH----RLVTKHVHPQYSMNPRIIN-DIALVKVTPPFRLERS-DISTIL-- 141
            :|.|:.   .|.|::.    |::|   ||  |.|....: ||||::      ||:| :.||::  
Mouse   696 LGLLDQSKRSASGVQELKLKRIIT---HP--SFNDFTFDYDIALLE------LEKSVEYSTVVRP 749

  Fly   142 --IGGSDRI---GEKVPVRLTGWGSTSPSTSSATLPDQLQALNYRTISNEDCNQ-KGFRVTRNEI 200
              :..:..:   |:.:.|  ||||.|....:.|.:   ||....|.|:...|.. ...::|...:
Mouse   750 ICLPDATHVFPAGKAIWV--TGWGHTKEGGTGALI---LQKGEIRVINQTTCEDLMPQQITPRMM 809

  Fly   201 C-ALAVQGQGACVGDSGGPLIRPGKQPHL--VGIVSYGSSTCAQGRPDVYTRVSSFLPYISQVIN 262
            | .....|..:|.|||||||....|...:  .|:||:|.....:.:|.||||    ||.:...|.
Mouse   810 CVGFLSGGVDSCQGDSGGPLSSAEKDGRMFQAGVVSWGEGCAQRNKPGVYTR----LPVVRDWIK 870

  Fly   263 Q 263
            :
Mouse   871 E 871

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3916NP_650167.1 Tryp_SPc 30..257 CDD:214473 76/253 (30%)
St14XP_036010597.1 SEA 108..198 CDD:460188
CUB 247..352 CDD:238001
CUB 360..464 CDD:238001
LDLa 474..506 CDD:238060
LDLa 512..543 CDD:238060
LDLa 545..579 CDD:238060
LDLa 587..622 CDD:238060
Tryp_SPc 635..872 CDD:238113 76/260 (29%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.