DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3916 and LOC1275498

DIOPT Version :10

Sequence 1:NP_650167.1 Gene:CG3916 / 41484 FlyBaseID:FBgn0038003 Length:267 Species:Drosophila melanogaster
Sequence 2:XP_061516545.1 Gene:LOC1275498 / 1275498 VectorBaseID:AGAMI1_008467 Length:293 Species:Anopheles gambiae


Alignment Length:57 Identity:16/57 - (28%)
Similarity:26/57 - (45%) Gaps:24/57 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly   241 SGL--------WCNFVISPDDFVRK----------NDVEK-----LEISEEKSMTIP 274
            |||        | ||..|.::||||          .:.:|     ||:..:::::||
Mosquito    75 SGLSYRREVMPW-NFAKSNEEFVRKVNALRAIGGTTNTKKALEVGLELMAQRNVSIP 130

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3916NP_650167.1 Tryp_SPc 30..257 CDD:214473 9/23 (39%)
LOC1275498XP_061516545.1 None

Return to query results.
Submit another query.