DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3916 and zgc:165423

DIOPT Version :10

Sequence 1:NP_650167.1 Gene:CG3916 / 41484 FlyBaseID:FBgn0038003 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_001093620.1 Gene:zgc:165423 / 100101646 ZFINID:ZDB-GENE-070720-11 Length:411 Species:Danio rerio


Alignment Length:111 Identity:41/111 - (36%)
Similarity:57/111 - (51%) Gaps:6/111 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   156 LTGWGSTSPSTSSATLPDQLQALNYRTISNEDCN---QKGFRVTRNEICALAVQ-GQGACVGDSG 216
            :|||| |..|..|...|..||.:|...:.|..||   ..|..:|.|.:||..:| |:.:|.||||
Zfish    35 ITGWG-TIESGVSLPSPQILQEVNVPIVGNNLCNCLYGGGSSITNNMMCAGLMQGGKDSCQGDSG 98

  Fly   217 GPLIRPGKQPHL-VGIVSYGSSTCAQGRPDVYTRVSSFLPYISQVI 261
            ||::.......: .|:||:|........|.||.|||.:..:|||.:
Zfish    99 GPMVIKSFNTWVQAGVVSFGKGCADPNYPGVYARVSQYQNWISQYV 144

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3916NP_650167.1 Tryp_SPc 30..257 CDD:214473 38/105 (36%)
zgc:165423NP_001093620.1 Tryp_SPc <2..142 CDD:238113 39/107 (36%)
Tryp_SPc 178..346 CDD:473915
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.