DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Su(var)3-9 and GCD11

DIOPT Version :9

Sequence 1:NP_524357.2 Gene:Su(var)3-9 / 41483 FlyBaseID:FBgn0263755 Length:635 Species:Drosophila melanogaster
Sequence 2:NP_010942.1 Gene:GCD11 / 856746 SGDID:S000000827 Length:527 Species:Saccharomyces cerevisiae


Alignment Length:419 Identity:108/419 - (25%)
Similarity:154/419 - (36%) Gaps:141/419 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 LQKQDLSNLDVSKLTPLSPEVISRQATINIGTIGHVAHGKSTVVKAISGVQTVRFKNELERNITI 78
            |.:|.| |.|.|||.|||.|:|:|||||||||||||||||||||:|||||||||||:||||||||
Yeast    75 LPEQPL-NPDFSKLNPLSAEIINRQATINIGTIGHVAHGKSTVVRAISGVQTVRFKDELERNITI 138

  Fly    79 KLERLSEKKIKNLLTSKQQRQQYEIKQRSMLRHLAELRRHSRFRRLCTKPASSSMPASTSSVDRR 143
            ||...:.|..|                                   |.:|         :..:..
Yeast   139 KLGYANAKIYK-----------------------------------CQEP---------TCPEPD 159

  Fly   144 TTRRSTSQTSLSPS----NSSG------YGSVFGCEEHDVDKIPSLNGFAKLKRR------RSSC 192
            ..|...|...:||.    ...|      :.|...|..||:.....|:|.|.:...      ..||
Yeast   160 CYRSFKSDKEISPKCQRPGCPGRYKLVRHVSFVDCPGHDILMSTMLSGAAVMDAALLLIAGNESC 224

  Fly   193 VGAPTPNSKRSKNNMGVIAKRPPKGEYVVERIECVEMDQYQPVFFVKWLGYHDSENTWESLANVA 257
               |.|.:.                    |.:..:|:.:.:.|..               |.|..
Yeast   225 ---PQPQTS--------------------EHLAAIEIMKLKHVII---------------LQNKV 251

  Fly   258 DCAEMEKFVERHQQLYEIYIAKITTELEKQLEALPLMENITVAEVDAYEPLNLQIDLILLAQYRA 322
            |....|                  :.||.|...|..:.. |:|:.....|::.|:...:.|    
Yeast   252 DLMREE------------------SALEHQKSILKFIRG-TIADGAPIVPISAQLKYNIDA---- 293

  Fly   323 AGSRSQREPQKIGERALKSMQIKRAQFVRRKQLADLALFEKRMNHVEKPSPPIR-VENNIDLDTI 386
                       :.|..:|::.:....|:...:|..:..|:     |.||...|. ::..:...:|
Yeast   294 -----------VNEFIVKTIPVPPRDFMISPRLIVIRSFD-----VNKPGAEIEDLKGGVAGGSI 342

  Fly   387 DSNFMYIHDNIIGKD--VPKPEAGIVGCK 413
            .:....:.|.|..:.  |.|.:.|.:.||
Yeast   343 LNGVFKLGDEIEIRPGIVTKDDKGKIQCK 371

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Su(var)3-9NP_524357.2 P-loop_NTPase 41..>80 CDD:304359 36/38 (95%)
CHROMO 217..268 CDD:237991 7/50 (14%)
PreSET 362..455 CDD:128744 12/55 (22%)
SET 477..609 CDD:214614
GCD11NP_010942.1 PTZ00327 74..524 CDD:240362 108/419 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S210
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.