DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Su(var)3-9 and Klk4

DIOPT Version :10

Sequence 1:NP_524357.2 Gene:Su(var)3-9 / 41483 FlyBaseID:FBgn0263755 Length:635 Species:Drosophila melanogaster
Sequence 2:NP_001004101.1 Gene:Klk4 / 408210 RGDID:1303228 Length:256 Species:Rattus norvegicus


Alignment Length:54 Identity:15/54 - (27%)
Similarity:22/54 - (40%) Gaps:15/54 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   461 SCDSSCSNRLVQ------HGRQVPLVLFKTANG---SG------WGVRAATALR 499
            |..||.|:|::|      |.:.....||...|.   ||      |.:.||..::
  Rat    23 SSASSISSRIIQGQDCLPHSQPWQAALFSEDNAFFCSGVLVHPQWVLSAAHCIQ 76

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Su(var)3-9NP_524357.2 PTZ00327 11..>80 CDD:240362
Chromo 219..268 CDD:459793
SET_SUV39H 388..634 CDD:380940 15/54 (28%)
Klk4NP_001004101.1 Tryp_SPc 35..249 CDD:238113 9/42 (21%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.