DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Su(var)3-9 and Klk7

DIOPT Version :10

Sequence 1:NP_524357.2 Gene:Su(var)3-9 / 41483 FlyBaseID:FBgn0263755 Length:635 Species:Drosophila melanogaster
Sequence 2:NP_036002.1 Gene:Klk7 / 23993 MGIID:1346336 Length:249 Species:Mus musculus


Alignment Length:47 Identity:14/47 - (29%)
Similarity:23/47 - (48%) Gaps:6/47 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   488 SGWGVRAATALR-KGEFVCEYIGEIITSDEANERGKAYDD-NGRTYL 532
            ||||...:..:. ..:.:|..: ::|:|.|..   |.|.| .|:|.|
Mouse   143 SGWGTTTSPDVTFPSDLMCSDV-KLISSRECK---KVYKDLLGKTML 185

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Su(var)3-9NP_524357.2 PTZ00327 11..>80 CDD:240362
Chromo 219..268 CDD:459793
SET_SUV39H 388..634 CDD:380940 14/47 (30%)
Klk7NP_036002.1 Tryp_SPc 25..241 CDD:214473 14/47 (30%)
Serine protease. /evidence=ECO:0000250 26..246 14/47 (30%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.