DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Su(var)3-9 and set-12

DIOPT Version :10

Sequence 1:NP_524357.2 Gene:Su(var)3-9 / 41483 FlyBaseID:FBgn0263755 Length:635 Species:Drosophila melanogaster
Sequence 2:NP_509306.2 Gene:set-12 / 187229 WormBaseID:WBGene00019584 Length:389 Species:Caenorhabditis elegans


Alignment Length:239 Identity:75/239 - (31%)
Similarity:103/239 - (43%) Gaps:61/239 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   403 PKPEAG---IVGCKCTEDTEECTASTKCCARFAGELFAYERSTRRLRLRPGSAIYECNSRCSCDS 464
            ||.:.|   :..|||..|   ||  |:.|:.||..                   .||...|   |
 Worm    45 PKRKTGLLTVTSCKCGTD---CT--TEECSNFANH-------------------RECPRGC---S 82

  Fly   465 SCSNRLVQHGRQVPLVLFKTANGSGWGVRAATALRKGEFVCEYIGEIITSDEANERGKAYDDNG- 528
            :|.|:..:..:...:..|.|.||.|.|:||...:..|:.:.||.||.||..|.|:|.|.|..:| 
 Worm    83 NCENQRFRKRQFCGVETFLTDNGIGHGLRATEEIATGKLILEYRGEAITKAEHNKRVKRYKKDGI 147

  Fly   529 -RTYLFDLDYNTAQDSEYTIDAANYGNISHFINHSCDPNLAVFPCWIEHLNVALP-----HLVFF 587
             .:|.|::..|      |.:|....||.:.||||||:|| |:...|      .:|     .|..|
 Worm   148 KHSYSFEVGRN------YYVDPTRKGNSARFINHSCNPN-ALVKVW------TVPDRPMKSLGIF 199

  Fly   588 TLRPIKAGEELSFDYIRADNEDVPYENLSTAVRVECRCGADNCR 631
            ..:.||.|||::|||..:...|.|           |:||...||
 Worm   200 ASKVIKPGEEITFDYGTSFRNDQP-----------CQCGEAACR 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Su(var)3-9NP_524357.2 PTZ00327 11..>80 CDD:240362
Chromo 219..268 CDD:459793
SET_SUV39H 388..634 CDD:380940 75/239 (31%)
set-12NP_509306.2 AWS 53..94 CDD:197795 16/67 (24%)
SET 97..236 CDD:394802 56/160 (35%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.