DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Su(var)3-9 and set-8

DIOPT Version :9

Sequence 1:NP_524357.2 Gene:Su(var)3-9 / 41483 FlyBaseID:FBgn0263755 Length:635 Species:Drosophila melanogaster
Sequence 2:NP_001359546.1 Gene:set-8 / 184086 WormBaseID:WBGene00008527 Length:407 Species:Caenorhabditis elegans


Alignment Length:159 Identity:46/159 - (28%)
Similarity:71/159 - (44%) Gaps:20/159 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   480 VLFKTANGSGWGVRAATALRKGEFVCEYIGEIITSDEANER---GKAYDDNG-RTYLFDLD---Y 537
            :|.|.....|:||.|...|..|..:.:|.||.|:..|...|   .|..:|.. :.|.|.:.   .
 Worm   253 LLLKFEKNKGYGVFATKILENGCVIGQYCGEYISEKEKARRDALAKVCNDKECKFYSFQVKLELL 317

  Fly   538 NTAQDSEYTIDAANYGNISHFINHSCDPNLAVFPCWIEHLNVALPHLVFFTLRPIKAGEELSFDY 602
            |..|..:..:|.::..||:..:|.||:||.......|...|:.:.::|..|.|.||.||||:.:|
 Worm   318 NELQAQKVYVDGSSVKNITAILNTSCEPNCTAIVEEISIQNIRIEYIVIKTKRTIKVGEELTINY 382

  Fly   603 IRADNEDVPYENLSTAVRVECRCGADNCR 631
                     ..|.|    .:|.||::.|:
 Worm   383 ---------KWNSS----FKCFCGSEKCK 398

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Su(var)3-9NP_524357.2 P-loop_NTPase 41..>80 CDD:304359
CHROMO 217..268 CDD:237991
PreSET 362..455 CDD:128744
SET 477..609 CDD:214614 40/135 (30%)
set-8NP_001359546.1 SET <106..400 CDD:225491 46/159 (29%)
SET 251..389 CDD:214614 42/148 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160165858
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.