DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Su(var)3-9 and set-23

DIOPT Version :9

Sequence 1:NP_524357.2 Gene:Su(var)3-9 / 41483 FlyBaseID:FBgn0263755 Length:635 Species:Drosophila melanogaster
Sequence 2:NP_741320.1 Gene:set-23 / 176969 WormBaseID:WBGene00021515 Length:244 Species:Caenorhabditis elegans


Alignment Length:256 Identity:80/256 - (31%)
Similarity:117/256 - (45%) Gaps:31/256 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   389 NFMYIHDNIIGKDVPKPEAGIV--GCKCTEDTEECTASTKC-CARFAGELFAYERSTRRLRLRPG 450
            |:..|...|.|..:.:.:...|  ||.|   ..||:::..| |.....:.:..:....    :..
 Worm     2 NYEKIDSTIPGPGISETDWNDVFEGCNC---EAECSSAAGCSCLINKIDNYTVDGKIN----KSS 59

  Fly   451 SAIYECNSRCSC---DSSCSNRLVQHGRQVPLVLFKTAN-GSGWGVRAATALRKGEFVCEYIGEI 511
            ..:.||:.:|:|   .:||.||:||.|.|..|.:|.|.. ..|:||||...:..|||||||.||.
 Worm    60 ELLIECSDQCACILLPTSCRNRVVQCGPQKKLEIFSTCEMAKGFGVRAGEQIAAGEFVCEYAGEC 124

  Fly   512 ITSDEANERGKAY--DDNGRTYLFDL-DYNTAQDSEYTIDAANYGNISHFINHSCDPNLAVFPCW 573
            |...|...|.:.:  |||   |...| ::...:..:..:|....|||..|:||||:||..:.   
 Worm   125 IGEQEVERRCREFRGDDN---YTLTLKEFFGGKPVKTFVDPRLRGNIGRFLNHSCEPNCEII--- 183

  Fly   574 IEHLNVALPHLVFFTLRPIKAGEELSFDYIRADNEDVPYENLSTAVRVECRCGADNCRKVL 634
            :..|...:|....|..|.|..||||.:||   .:..:..||     |..|.|.::.|||.|
 Worm   184 LARLGRMIPAAGIFAKRDIVRGEELCYDY---GHSAIEGEN-----RKLCLCKSEKCRKYL 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Su(var)3-9NP_524357.2 P-loop_NTPase 41..>80 CDD:304359
CHROMO 217..268 CDD:237991
PreSET 362..455 CDD:128744 12/68 (18%)
SET 477..609 CDD:214614 47/135 (35%)
set-23NP_741320.1 Pre-SET <6..81 CDD:282838 17/81 (21%)
SET 89..213 CDD:214614 47/132 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D753093at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.