DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Su(var)3-9 and set-13

DIOPT Version :9

Sequence 1:NP_524357.2 Gene:Su(var)3-9 / 41483 FlyBaseID:FBgn0263755 Length:635 Species:Drosophila melanogaster
Sequence 2:NP_494371.1 Gene:set-13 / 173626 WormBaseID:WBGene00019690 Length:402 Species:Caenorhabditis elegans


Alignment Length:350 Identity:85/350 - (24%)
Similarity:135/350 - (38%) Gaps:68/350 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   333 KIGERALKSMQIKRAQFVRRKQLADLALFEKRMNHVEKPSPPIRVENNI-DLDTID-------SN 389
            |:..|.|:|.....|...:.:...:    |..:..|.| .|.||:.:|: |....|       |.
 Worm    31 KMSSRTLRSSSSSNAISTKTQPKTE----EAPLIPVTK-GPVIRMTSNMADKAQNDHSMWPSTSK 90

  Fly   390 FMYIHDNIIGKDVPKPEAGIV------------GCKCTEDTEECTASTKC-CARFAGELFAYERS 441
            |..|..|::|:.|.|.....:            ||:..:|   |:.:..| |.:.|..|..:..|
 Worm    91 FESIWGNVLGERVNKSTIAAIREGMKIENKVTCGCRPGQD---CSTNPACRCFQTASRLREHFGS 152

  Fly   442 TRRLRLRPGSAI---------YECNSRCSCDSSCSNRLVQHGRQVPLVLFK--TANGSGWGVRAA 495
            ....|.:|...:         :.|:..|.|...|:...:|...:.|...||  ..:|.|:.|.:|
 Worm   153 DILTRGKPVKTVDTMYWDRPMFACSGSCGCKGQCNLNALQDICEDPAKKFKITRTDGKGFCVYSA 217

  Fly   496 TALRKGEFVCEYIGEI-----ITSDEANERGKAYDDNGRTYLFDL---------DYN----TAQD 542
            ..::||..|.|:.|||     |.|:...|:......|..|.|.|.         .|.    :|..
 Worm   218 RVIKKGSPVLEFSGEITDYLAIKSNADIEQYSIMLYNNETKLCDFFSKEENLSSKYKKILWSAYR 282

  Fly   543 SEYTIDAANYGNISHFINHSCDPNLAVFPCWIEHLNVALPHLVFFTLRPIKAGEELSFDYIRADN 607
            |:..|:..|.||.:.|.:|.|..|:.:...:....:.|...:|.|....||.|.||:|:|     
 Worm   283 SKAWINPLNRGNCARFFSHGCKANMELGRVFQGGFSPADMKIVLFAKEIIKPGTELTFNY----- 342

  Fly   608 EDVPYENLSTAVRVECRCGADNCRK 632
             ...|:.:....:  |.|.|  |:|
 Worm   343 -GPSYKEIFLGNK--CLCEA--CKK 362

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Su(var)3-9NP_524357.2 P-loop_NTPase 41..>80 CDD:304359
CHROMO 217..268 CDD:237991
PreSET 362..455 CDD:128744 27/122 (22%)
SET 477..609 CDD:214614 42/151 (28%)
set-13NP_494371.1 SET 200..348 CDD:214614 42/153 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160165859
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1082
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.