Protein Alignment Rsbp15 and Ropn1

DIOPT Version :9

• Sequence 1: NP_650164.1
• Gene: Rsbp15 / 41481
• FlyBaseID: FBgn0038000
• Length: 421
• Species: Drosophila melanogaster
• Sequence 2: NP_109669.1
• Gene: Ropn1 / 76378
• MGIID: 1923628
• Length: 212
• Species: Mus musculus
• Alignment Length: 33
• Identity: 13/33 - (39%)
• Similarity: 19/33 - (57%)
• Gaps: 2/33 - (6%)

  Fly    17 VPEGLPELLSDVTREVLRCQPKKECLCQFIIDY 49
            :|..|||||...|::.:|.||..  |.|:..:|
Mouse    10 IPPELPELLKQFTKDAIRTQPPD--LIQWAAEY 40

Known Domains

Gene	Sequence	Domain	Region	External ID	Identity
Rsbp15	NP_650164.1	DD_R_PKA	17..57	CDD:295380	13/33 (39%)
		IQ	190..210	CDD:197470
Ropn1	NP_109669.1	DD_R_PKA	10..>41	CDD:351815	13/33 (39%)
		Interaction with RHPN1. /evidence=ECO:0000269|PubMed:10591629	209..212

Information from Original Tools

Tool	Simple Score	Weighted Score	Original Tool Information
			BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	1	1.100	-	-	O	PTHR14952
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	1.100