DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rsbp15 and Ropn1l

DIOPT Version :9

Sequence 1:NP_650164.1 Gene:Rsbp15 / 41481 FlyBaseID:FBgn0038000 Length:421 Species:Drosophila melanogaster
Sequence 2:NP_001178015.1 Gene:Ropn1l / 685646 RGDID:1591367 Length:218 Species:Rattus norvegicus


Alignment Length:217 Identity:49/217 - (22%)
Similarity:76/217 - (35%) Gaps:67/217 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 QAINVPEGLPELLSDVTREVLRCQPKKECLCQFIIDYLHSV-------IVTREKAMVAKTILDRS 70
            |.|::|..||::|...|:..:|.||..  :.|:...|..::       :..|.:..||....|..
  Rat    11 QQIHIPPELPDILKQFTKAAIRTQPAD--VLQWSAGYFSALSRGDPLPVKDRIEMPVATQKTDTG 73

  Fly    71 LRQ-VDSIISDLC-------VCDLSKEKSELMGQVLEDCFRNFLEKRRCEMRRGKQAIKFEDVDI 127
            |.| :..::...|       :.||.|:...|       |..  :||.|.          ..|:|.
  Rat    74 LTQGLLKVLHKQCSHKQYVELADLEKKWKNL-------CLP--VEKFRA----------IVDLDP 119

  Fly   128 LEELLQKCKF------------------------TDEELVMSRPAIES-AYKRFVDAYMSA---E 164
            .|:.::..||                        :|.|...:|...|: ||   :..|:||   |
  Rat   120 SEDKMEWIKFLALGCSSLGGTLNTAMKNVCEILTSDPEGGPARIPFETFAY---IYQYLSALDPE 181

  Fly   165 RGADGTELLYQYFRDRELKRIN 186
            ..|..||......||....|.|
  Rat   182 FSAVETETYLANLRDTSESRKN 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rsbp15NP_650164.1 DD_R_PKA 17..57 CDD:295380 10/46 (22%)
IQ 190..210 CDD:197470
Ropn1lNP_001178015.1 DD_R_PKA 15..51 CDD:413389 10/37 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR14952
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.