DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rsbp15 and Iqce

DIOPT Version :9

Sequence 1:NP_650164.1 Gene:Rsbp15 / 41481 FlyBaseID:FBgn0038000 Length:421 Species:Drosophila melanogaster
Sequence 2:XP_017453977.1 Gene:Iqce / 304318 RGDID:1311349 Length:822 Species:Rattus norvegicus


Alignment Length:399 Identity:88/399 - (22%)
Similarity:135/399 - (33%) Gaps:142/399 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 DLSKEKSELMGQVLE---------DCFRNFLEKRRCEMRRG-------KQAIKFEDVDILEELLQ 133
            :||..:.:|:|:.||         |     |||.....|.|       :||::.|    :|.|.:
  Rat   413 ELSALQEQLLGKDLEMKQMLQSKID-----LEKELETAREGEKESQEREQALREE----VEALTK 468

  Fly   134 KCKFTDEELVMSRPAIESAYKRFV----------------------DAYMSAER--GADGTELLY 174
            ||:..:|   ..|...:.....|:                      |:..:|:.  |.||     
  Rat   469 KCQELEE---AKRQETQERQDSFIAMTHEAHPEVHAPSPCSRHSEPDSDNNADNNAGEDG----- 525

  Fly   175 QYFRDRELKRINEAMRNQAAI-TIQAAWRGYWVRLQFPQEVCVCVCAAEKEDDGEEKRR------ 232
                ..:...:....|.:||| |:||.|:.:..:                      ||:      
  Rat   526 ----GSQPPALCSEERREAAIRTLQAQWKAHRCK----------------------KRKAALDEV 564

  Fly   233 EQAASVLQRFFRKVMLRVVTKPIVDPCAEPTEPTEVDASSSPDTAKDGYDDVNLSTVPTTAAITA 297
            .|||:|||..||..:.|  :|.:         |.:...|.||             ::|...:...
  Rat   565 SQAATVLQAAFRGHLAR--SKLV---------PNKAPDSRSP-------------SLPGLPSPLN 605

  Fly   298 GPTPLPTAPGTVPPSAPGTAP---------------ATARTSATAIAEP--EAHEEAAEAQPAEE 345
            ..:|.|..|..:.|:......               |.||..|....|.  .:..||....|:| 
  Rat   606 QSSPSPPVPSPISPAEDSLTQEESIIVIQSILRGYLAQARVIANCCQEKTGPSQREAVSVTPSE- 669

  Fly   346 APAAEAPADEAAP------APAEEAAPPPAEEAAPEAAEEPAPPPPPEEAAAPPPPAEEPAPTEG 404
              :|..|:.||:|      ..:||:....||:  .:.||||..|.|...|.:....|||......
  Rat   670 --SASPPSLEASPEWCSSGKDSEESGGEVAED--EDEAEEPPDPQPYSGALSMGLHAEEELRETA 730

  Fly   405 AAPPAEEAP 413
            |:.||...|
  Rat   731 ASEPAPSVP 739

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rsbp15NP_650164.1 DD_R_PKA 17..57 CDD:295380
IQ 190..210 CDD:197470 8/20 (40%)
IqceXP_017453977.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR14952
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.