DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rsbp15 and Ropn1l

DIOPT Version :10

Sequence 1:NP_650164.1 Gene:Rsbp15 / 41481 FlyBaseID:FBgn0038000 Length:421 Species:Drosophila melanogaster
Sequence 2:NP_665851.2 Gene:Ropn1l / 252967 MGIID:2182357 Length:218 Species:Mus musculus


Alignment Length:200 Identity:40/200 - (20%)
Similarity:69/200 - (34%) Gaps:62/200 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 QAINVPEGLPELLSDVTREVLRCQPKKECLCQFIIDYLHSV-------IVTREKAMVAKTILDRS 70
            |.|::|..||::|...|:..:|.||..  :.|:...|..::       :..|.:..||....|..
Mouse    11 QQIHIPPELPDILKQFTKAAIRTQPAD--VLQWSAGYFSALSRGDPLPVKDRIEMPVATQKTDTG 73

  Fly    71 LRQ-VDSIISDLC-------VCDLSKEKSEL--------------------------------MG 95
            |.| :..::...|       :.||.|:...|                                :|
Mouse    74 LTQGLLKVLHKQCSHKQYVELADLEKKWKNLCLPVEKLRTILELDPCEDKIEWIKFLALGCSSLG 138

  Fly    96 QVLEDCFRNFLEKRRCEMRRGKQAIKFEDVDILEELLQKCKFTDEELVMSRPAIESAYKRFVDAY 160
            :.|....:|..|....:...|...|.||....:.:.|..   .|.||    ||:|:      :.|
Mouse   139 RTLNTAMKNVCEILTSDPEGGPARIPFETFAYVYQYLSG---LDPEL----PAVET------ENY 190

  Fly   161 MSAER 165
            :::.|
Mouse   191 LTSLR 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rsbp15NP_650164.1 DD_RII_PKA-like 17..52 CDD:438517 10/34 (29%)
IQCD 187..>210 CDD:467745
PLN03209 <221..326 CDD:178748
Ropn1lNP_665851.2 DD_ROP 10..52 CDD:438555 12/42 (29%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.