DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rsbp15 and K08D12.6

DIOPT Version :9

Sequence 1:NP_650164.1 Gene:Rsbp15 / 41481 FlyBaseID:FBgn0038000 Length:421 Species:Drosophila melanogaster
Sequence 2:NP_741325.1 Gene:K08D12.6 / 176980 WormBaseID:WBGene00019540 Length:668 Species:Caenorhabditis elegans


Alignment Length:209 Identity:67/209 - (32%)
Similarity:79/209 - (37%) Gaps:61/209 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   254 PIVDPCAEPTEPTEVDASSSPDTAKD--------GYDDVNLSTVPTTAAITAGPTPLPTAPGTVP 310
            |:..|...||.....|..|:...|.|        .|.|..::..|..||......|:..||..||
 Worm   382 PVAVPAPAPTAAPAPDCGSAAPAATDSGYRSKRNAYGDEQVTPAPAAAAEAPADAPVEQAPVAVP 446

  Fly   311 PSAPGTAPATARTSATAIAEPEAHEEAAEAQPAEEAPAAEAPA---------------DEAAPAP 360
            ..||..|||               .:...|.||..||||.|||               ::..|||
 Worm   447 APAPAAAPA---------------PDCGSAAPAAAAPAAAAPAATDSGYRSKRNAYGDEQVTPAP 496

  Fly   361 AEEAAPPPAE---EAAPEAAEEPAPPPPPEEAAAPPPPAEE----------------PAPTEGAA 406
            |  |||.||:   |.||.|...|||...| ..|||.|.|.:                |||...|.
 Worm   497 A--AAPAPADAPVEQAPVAVPAPAPAAAP-APAAPAPAATDSGYRSKRNAYGDEQVTPAPAAAAE 558

  Fly   407 PPAEEAPAEEAPAA 420
            .|| :||.|:||.|
 Worm   559 APA-DAPVEQAPVA 571

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rsbp15NP_650164.1 DD_R_PKA 17..57 CDD:295380
IQ 190..210 CDD:197470
K08D12.6NP_741325.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
10.960

Return to query results.
Submit another query.