DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4860 and Acox3

DIOPT Version :9

Sequence 1:NP_650163.2 Gene:CG4860 / 41480 FlyBaseID:FBgn0037999 Length:415 Species:Drosophila melanogaster
Sequence 2:NP_445791.2 Gene:Acox3 / 83522 RGDID:69245 Length:700 Species:Rattus norvegicus


Alignment Length:387 Identity:83/387 - (21%)
Similarity:135/387 - (34%) Gaps:107/387 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 PAEQVRRLGELGLMSVTVREEYGGSGLDYQAYAIGMEEVARGDAAVSIVMGVNNLY--------- 125
            |.|:.|.|..|....|.   |||         ....|::.:....:.::|....:|         
  Rat    70 PLEKERELNFLRCKRVF---EYG---------FFNAEDMLKNPLKILVLMNCLGMYDWSLANKCV 122

  Fly   126 ----------LGAVQQHGTEQQKQDFLVPYTQGEHIAFYALSEPGNGSDAGAASTTAKLQG---- 176
                      :|:..:|..:     :|......|....:||:|..:||:..|..|||....    
  Rat   123 LHMLVFGSTIIGSGSEHHFK-----YLEKIYNLEIFGCFALTELSHGSNTKAMRTTAHYDPATQE 182

  Fly   177 ---DSYQINGTKAWISN-SKEASGGIVFA---TVDKSMKHKGITAFLT----PK---DVPGLSIA 227
               .|......|.|:.| .|.|:..:|||   |.|...  :|:.:||.    ||   .:||:.:.
  Rat   183 FILHSPDFEAAKFWVGNLGKTATHAVVFAQLYTPDGQC--RGLHSFLVQIRDPKTLLPMPGVMVG 245

  Fly   228 KKESKMGMRATSTCQLVLEDVHVPRSRVLGAAGD---------GFKIAMQ-------SLDCGRIG 276
            ....|:|.........:...|.:||..:|...|:         .||...|       ||..|||.
  Rat   246 DMGKKLGQNGLDNGFAMFHKVRIPRQNLLDRTGNVTSEGTYNTPFKDVRQRLGASLGSLSSGRIS 310

  Fly   277 IAAQATGIAQAALELAVDYSQKRVAFGKHLARLQLIQQKLADMATRVEISRLLTW-RAAWLKDN- 339
            |.:.:....:.|:.:|:.:|..|..||      ...::::..:...::..|||.: .||:..|: 
  Rat   311 IISISVVNLKLAVIIAIRFSATRRQFG------PTDKEEIPVLEYPLQQWRLLPYLAAAYALDHF 369

  Fly   340 ---------------------------GLPITKEAAMAKLHASESATFCAHQCIQILGGMGY 374
                                       |..|...|:..|..||.:|.....:|.:..||.||
  Rat   370 SKTIFLDLIELQRGRQSGDHSDRQAELGREIHALASAGKPLASWTAQRGIQECREACGGHGY 431

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4860NP_650163.2 CaiA 37..414 CDD:224871 83/387 (21%)
SCAD_SBCAD 39..410 CDD:173847 83/387 (21%)
Acox3NP_445791.2 AXO 19..672 CDD:173839 83/387 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1960
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.