DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4860 and ACOX3

DIOPT Version :9

Sequence 1:NP_650163.2 Gene:CG4860 / 41480 FlyBaseID:FBgn0037999 Length:415 Species:Drosophila melanogaster
Sequence 2:NP_001362712.1 Gene:ACOX3 / 8310 HGNCID:121 Length:700 Species:Homo sapiens


Alignment Length:366 Identity:88/366 - (24%)
Similarity:140/366 - (38%) Gaps:83/366 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 RRLGELGLMSVTVREEYGGSGLDYQA--YAIGMEEVARGDAAVSIVMGVNNLYLG-AVQQHGTEQ 136
            :|:.|...:||   |:...|.|...|  ..:||.     |::::....:::|..| ||...|:|:
Human    83 KRIFEYDFLSV---EDMFKSPLKVPALIQCLGMY-----DSSLAAKYLLHSLVFGSAVYSSGSER 139

  Fly   137 QKQDFLVPYTQG----EHIAFYALSEPGNGSDAGAASTTAKLQG-------DSYQINGTKAWISN 190
            .     :.|.|.    |....:||:|..:||:..|..|||....       .|......|.|:.|
Human   140 H-----LTYIQKIFRMEIFGCFALTELSHGSNTKAIRTTAHYDPATEEFIIHSPDFEAAKFWVGN 199

  Fly   191 -SKEASGGIVFA--TVDKSMKHKGITAFLT----PK---DVPGLSIAKKESKMGMRATSTCQLVL 245
             .|.|:..:|||  .|.....| |:..|:.    ||   .:||:.:.....|:|.........:.
Human   200 MGKTATHAVVFAKLCVPGDQCH-GLHPFIVQIRDPKTLLPMPGVMVGDIGKKLGQNGLDNGFAMF 263

  Fly   246 EDVHVPRSRVLGAAGD----------------GFKIAMQSLDCGRIGIAAQATGIAQAALELAVD 294
            ..|.|||..:|...||                .|..::.||..||:.|.:.|....:.|:.:|:.
Human   264 HKVRVPRQSLLNRMGDVTPEGTYVSPFKDVRQRFGASLGSLSSGRVSIVSLAILNLKLAVAIALR 328

  Fly   295 YSQKRVAFG--------------------KHLARLQLI----QQKLADMATRVEISRLLTW--RA 333
            :|..|..||                    .:||.:..:    :....|:   ||:.|.|..  |:
Human   329 FSATRRQFGPTEEEEIPVLEYPMQQWRLLPYLAAVYALDHFSKSLFLDL---VELQRGLASGDRS 390

  Fly   334 AWLKDNGLPITKEAAMAKLHASESATFCAHQCIQILGGMGY 374
            |...:.|..|...|:.:|..||.:......:|.:..||.||
Human   391 ARQAELGREIHALASASKPLASWTTQQGIQECREACGGHGY 431

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4860NP_650163.2 CaiA 37..414 CDD:224871 88/366 (24%)
SCAD_SBCAD 39..410 CDD:173847 88/366 (24%)
ACOX3NP_001362712.1 AXO 19..672 CDD:173839 88/366 (24%)
Microbody targeting signal. /evidence=ECO:0000250|UniProtKB:Q63448 698..700
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1960
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.