DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4860 and ACOX2

DIOPT Version :9

Sequence 1:NP_650163.2 Gene:CG4860 / 41480 FlyBaseID:FBgn0037999 Length:415 Species:Drosophila melanogaster
Sequence 2:NP_003491.1 Gene:ACOX2 / 8309 HGNCID:120 Length:681 Species:Homo sapiens


Alignment Length:441 Identity:105/441 - (23%)
Similarity:178/441 - (40%) Gaps:79/441 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 IIAGGNRGIACLAAL-SETHQILQKTCREFANAELAPKARHHD--REELYPAEQVRRLGELGLMS 84
            |:.||.:..|....: |..|...:.:|::  |..:....|:..  |...:.....||||.|    
Human    39 ILDGGAQNTALRRKVESIIHSYPEFSCKD--NYFMTQNERYKAAMRRAFHIRLIARRLGWL---- 97

  Fly    85 VTVREEYGGSGLDYQAYAIGMEEVARGDAAVSIVMGVNNLYLGAVQQHGTEQQ--KQDFLVPYTQ 147
                |:....|..|:|.:        ||.|::|    :.:::.|::..|:|:|  |.|.|....|
Human    98 ----EDGRELGYAYRALS--------GDVALNI----HRVFVRALRSLGSEEQIAKWDPLCKNIQ 146

  Fly   148 GEHIAFYALSEPGNG-------SDAGAASTTAKLQGDSYQINGTKAWISN-SKEASGGIVFATVD 204
              .||.||.:|.|:|       ::|...:.|.:....|..:..||.|..: .:.|:..:|.|.:.
Human   147 --IIATYAQTELGHGTYLQGLETEATYDAATQEFVIHSPTLTATKWWPGDLGRSATHALVQAQLI 209

  Fly   205 KSMKHKGITAFLTP-------KDVPGLSIAKKESKMGMRATSTCQLVLEDVHVPR----SRVLGA 258
            .|...:|:.||:.|       ..:||:.|.....||....|....|.|..|.|||    ||....
Human   210 CSGARRGMHAFIVPIRSLQDHTPLPGIIIGDIGPKMDFDQTDNGFLQLNHVRVPRENMLSRFAQV 274

  Fly   259 AGDGFKIAMQSLDCGRIG--------IAAQATGIAQAALELAVDYS----QKRVAFGKHLARL-- 309
            ..||..:.:.:.....:.        ::.:...|.|.|..:|:.||    |.|:......|::  
Human   275 LPDGTYVKLGTAQSNYLPMVVVRVELLSGEILPILQKACVIAMRYSVIRRQSRLRPSDPEAKVLD 339

  Fly   310 -QLIQQKL-ADMATRVEISRLLTWRAAWLKDNGLPITKE--AAMAKLHA---------SESATFC 361
             |..|||| ..:|.......|......:.:.:...|..:  :.:.:|||         ||..|..
Human   340 YQTQQQKLFPQLAISYAFHFLAVSLLEFFQHSYTAILNQDFSFLPELHALSTGMKAMMSEFCTQG 404

  Fly   362 AHQCIQILGGMGYT--TDLPAELYYRNARVTEIYEGTSEIQRIVIANAVLR 410
            |..|.:..||.||:  :.||:.:...:|..|  |||.:.:..:.:|..:::
Human   405 AEMCRRACGGHGYSKLSGLPSLVTKLSASCT--YEGENTVLYLQVARFLVK 453

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4860NP_650163.2 CaiA 37..414 CDD:224871 101/427 (24%)
SCAD_SBCAD 39..410 CDD:173847 100/422 (24%)
ACOX2NP_003491.1 ACAD 20..655 CDD:324545 105/441 (24%)
Microbody targeting signal. /evidence=ECO:0000255 679..681
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1960
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.