DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4860 and ACX4

DIOPT Version :9

Sequence 1:NP_650163.2 Gene:CG4860 / 41480 FlyBaseID:FBgn0037999 Length:415 Species:Drosophila melanogaster
Sequence 2:NP_190752.1 Gene:ACX4 / 824347 AraportID:AT3G51840 Length:436 Species:Arabidopsis thaliana


Alignment Length:375 Identity:119/375 - (31%)
Similarity:184/375 - (49%) Gaps:10/375 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 LSETHQILQKTCREFANAELAPKARHHDREELYPAEQVRRLGELGLMSVTVREEYGGSGLDYQAY 101
            |:...|.::|..||....|:||....:..:..:|.....:||.:|:...::: .||..||...|.
plant    55 LTPEEQAIRKKVRECMEKEVAPIMTEYWEKAEFPFHITPKLGAMGVAGGSIK-GYGCPGLSITAN 118

  Fly   102 AIGMEEVARGDAAVS-IVMGVNNLYLGAVQQHGTEQQKQDFLVPYTQGEHIAFYALSEPGNGSDA 165
            ||...|:||.||:.| .::..::|.:..:...|:|.||:.:|....|...:|.:||:||.|||||
plant   119 AIATAEIARVDASCSTFILVHSSLGMLTIALCGSEAQKEKYLPSLAQLNTVACWALTEPDNGSDA 183

  Fly   166 GAASTTA-KLQGDSYQINGTKAWISNSKEASGGIVFATVDKSMKHKGITAFLTPKDVPGLSIAKK 229
            ....||| |::| .::|||.|.||.||..|...|:||   ::.....|..|:..||.|||...|.
plant   184 SGLGTTATKVEG-GWKINGQKRWIGNSTFADLLIIFA---RNTTTNQINGFIVKKDAPGLKATKI 244

  Fly   230 ESKMGMRATSTCQLVLEDVHVP-RSRVLGAAGDGFKIAMQSLDCGRIGIAAQATGIAQAALELAV 293
            .:|:|:|......::|::|.|| ..|:.|.  :.|:...:.|...|:.:|.|..||:....::..
plant   245 PNKIGLRMVQNGDILLQNVFVPDEDRLPGV--NSFQDTSKVLAVSRVMVAWQPIGISMGIYDMCH 307

  Fly   294 DYSQKRVAFGKHLARLQLIQQKLADMATRVEISRLLTWRAAWLKDNGLPITKEAAMAKLHASESA 358
            .|.::|..||..||..||.||||..|...|:...|:.||...|.:.|.....:|::.|...|..|
plant   308 RYLKERKQFGAPLAAFQLNQQKLVQMLGNVQAMFLMGWRLCKLYETGQMTPGQASLGKAWISSKA 372

  Fly   359 TFCAHQCIQILGGMGYTTDLPAELYYRNARVTEIYEGTSEIQRIVIANAV 408
            ...|....::|||.|...|......:.:......||||.:|..:|....|
plant   373 RETASLGRELLGGNGILADFLVAKAFCDLEPIYTYEGTYDINTLVTGREV 422

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4860NP_650163.2 CaiA 37..414 CDD:224871 119/375 (32%)
SCAD_SBCAD 39..410 CDD:173847 118/373 (32%)
ACX4NP_190752.1 PLN02526 27..436 CDD:178141 119/375 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1960
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D589058at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.