DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4860 and IVD

DIOPT Version :9

Sequence 1:NP_650163.2 Gene:CG4860 / 41480 FlyBaseID:FBgn0037999 Length:415 Species:Drosophila melanogaster
Sequence 2:NP_190116.1 Gene:IVD / 823668 AraportID:AT3G45300 Length:409 Species:Arabidopsis thaliana


Alignment Length:410 Identity:150/410 - (36%)
Similarity:213/410 - (51%) Gaps:19/410 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 WSARIIAG----------GNRGIACLAALSETHQILQKTCREFANAELAPKARHHDREELYPAE- 72
            :|||.|.|          .:|..:.|  ..:|....:::..:||...:||.|...|:...:|.: 
plant     5 FSARSILGYAVKTRRRSFSSRSSSLL--FDDTQLQFKESVSKFAQDNIAPHAERIDKTNSFPKDV 67

  Fly    73 -QVRRLGELGLMSVTVREEYGGSGLDYQAYAIGMEEVARGDAAVSIVMGV-NNLYLGAVQQHGTE 135
             ..:.:||..|..:|..|||||.||.|..:.|.|||::|...:|::..|. :||.:..:.::||.
plant    68 NLWKLMGEFNLHGITAPEEYGGLGLGYLYHCIAMEEISRASGSVALSYGAHSNLCINQLVRNGTA 132

  Fly   136 QQKQDFLVPYTQGEHIAFYALSEPGNGSDAGAASTTAKLQGDSYQINGTKAWISNSKEASGGIVF 200
            .||:.:|.....|||:...|:|||..|||.......|:.....|.:||.|.|.:|...|...:|:
plant   133 AQKEKYLPKLISGEHVGALAMSEPNAGSDVVGMKCKAEKVDGGYILNGNKMWCTNGPSAETLVVY 197

  Fly   201 ATVDKSMKHKGITAFLTPKDVPGLSIAKKESKMGMRATSTCQLVLEDVHVPRSRVLGAAGDGFKI 265
            |..|.....||||||:..|.:.|.|.|:|..|:|||.:.||:||.|:..||...:|...|.|..:
plant   198 AKTDTKAGSKGITAFIIEKGMTGFSTAQKLDKLGMRGSDTCELVFENCFVPEENILDKEGKGVYV 262

  Fly   266 AMQSLDCGRIGIAAQATGIAQAALELAVDYSQKRVAFGKHLARLQLIQQKLADMATRVEISRLLT 330
            .|..||..|:.:||...||.||.|:..:.|.::|..||:.:...|.||.|:|||.|.::.||...
plant   263 LMSGLDLERLVLAAGPLGIMQACLDNVLPYIRQREQFGRPVGEFQFIQGKVADMYTALQSSRSYV 327

  Fly   331 WRAAWLKDNGLPITKEAAMAKLHASESATFCAHQCIQILGGMGYTTDLPAELYYRNARVTEIYEG 395
            :..|...|||....|:.|...|.|:|.||..|.|.||.|||.||..:.......|:|::.||..|
plant   328 YSVARDCDNGKVDPKDCAGTILCAAERATQVALQAIQCLGGNGYINEYATGRLLRDAKLYEIGAG 392

  Fly   396 TSEIQRIVIANAVLRELGKE 415
            ||||:||||.    |||.||
plant   393 TSEIRRIVIG----RELFKE 408

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4860NP_650163.2 CaiA 37..414 CDD:224871 141/379 (37%)
SCAD_SBCAD 39..410 CDD:173847 138/373 (37%)
IVDNP_190116.1 PLN02519 32..409 CDD:215284 143/381 (38%)
IVD 32..407 CDD:173845 141/378 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1960
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D589058at2759
OrthoFinder 1 1.000 - - FOG0000508
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.