DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4860 and Acox3

DIOPT Version :9

Sequence 1:NP_650163.2 Gene:CG4860 / 41480 FlyBaseID:FBgn0037999 Length:415 Species:Drosophila melanogaster
Sequence 2:XP_006504259.1 Gene:Acox3 / 80911 MGIID:1933156 Length:755 Species:Mus musculus


Alignment Length:376 Identity:84/376 - (22%)
Similarity:140/376 - (37%) Gaps:85/376 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 PAEQVRRLGELGLMSVTVREEYGGSGLDYQAYAIGMEEVARGDAAVSIVMGVNNLY--------- 125
            |.|::|.|..|....|.   |||         ...:||:.:....:.:::....:|         
Mouse    70 PLEKLRELNFLRCKRVF---EYG---------FFKVEELLKNPLKILVLINCLGMYDWSLANKCV 122

  Fly   126 -----LG-AVQQHGTEQQKQDFLVPYTQGEHIAFYALSEPGNGSDAGAASTTAKLQGDSYQ---- 180
                 .| .|...|:|:..: :|......|....:||:|..:||:..|..|||....|:.:    
Mouse   123 LHMLVFGTTVFVSGSEKHFK-YLEKIYSLEIFGCFALTELSHGSNTKAMRTTAHYDPDTQEFILH 186

  Fly   181 ---INGTKAWISN-SKEASGGIVFAT--VDKSMKHKGITAFL-------TPKDVPGLSIAKKESK 232
               ....|.|:.| .|.|:..:|||.  :.....| |:.:||       |...:.|:.:.....|
Mouse   187 SPDFEAAKFWVGNLGKTATHAVVFAQLYMPDGQCH-GLHSFLVQIRDTKTLLPMTGVMVGDIGKK 250

  Fly   233 MGMRATSTCQLVLEDVHVPRSRVLGAAGD---------GFKIAMQ-------SLDCGRIGIAAQA 281
            :|.........:...|.:||..:|...|:         .||...|       ||..|||.|.:.:
Mouse   251 LGQNGLDNGFAMFNKVRIPRQNLLDRTGNITSEGTYNSPFKDVRQRLGASLGSLSSGRISIISMS 315

  Fly   282 TGIAQAALELAVDYSQKRVAFG----KHLARLQLIQQK------LA-----DMATRVEISRLLTW 331
            ....:.|:.:|:.:|..|..||    :.:..|:...|:      ||     |..::.....|:..
Mouse   316 VVNLKLAVSIAIRFSATRCQFGPTDKEEIPVLEYPLQQWRILPYLAAAYALDHFSKTIFMDLIEV 380

  Fly   332 RAAWLKDN--------GLPITKEAAMAKLHASESATFCAHQCIQILGGMGY 374
            ::|.|:.:        |..|...|:..|..||.:|.....:|.:..||.||
Mouse   381 QSARLRGDHSDQQAELGREIHALASAGKPLASWTAQRGIQECREACGGHGY 431

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4860NP_650163.2 CaiA 37..414 CDD:224871 84/376 (22%)
SCAD_SBCAD 39..410 CDD:173847 84/376 (22%)
Acox3XP_006504259.1 AXO 19..663 CDD:173839 84/376 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1960
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.