DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4860 and acadl

DIOPT Version :9

Sequence 1:NP_650163.2 Gene:CG4860 / 41480 FlyBaseID:FBgn0037999 Length:415 Species:Drosophila melanogaster
Sequence 2:NP_001039250.1 Gene:acadl / 734116 XenbaseID:XB-GENE-958719 Length:444 Species:Xenopus tropicalis


Alignment Length:410 Identity:130/410 - (31%)
Similarity:197/410 - (48%) Gaps:53/410 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 GNRGIACLAALSETHQILQKTCREFANAELAPKARHHDREELYPAEQVRR-----LGELGLMSVT 86
            |.|.|     .|..|.|.:::.|:|...|:.|   :|  .|...|.||.|     .|:.||:..:
 Frog    62 GTRRI-----FSSDHDIFRESARKFFQQEVVP---YH--AEWEKAGQVSRNLWEKAGQQGLLGTS 116

  Fly    87 VREEYGGSGLDYQAYAIGMEEVARGDAAVSIVMGVN----------NLYLGAVQQHGTEQQKQDF 141
            ..||:||.|.|..:.||..||          .|.||          ::.:..:.::|::.|.:.:
 Frog   117 TPEEHGGIGGDILSSAIVWEE----------QMYVNCTGPGFSLHSDIVMPYISRYGSKSQVEKY 171

  Fly   142 LVPYTQGEHIAFYALSEPGNGSDAGAASTTAKLQGDSYQINGTKAWISNSKEASGGIVFATVDKS 206
            :...|.|:.|...|::|||.|||.....|.||..|..:.:||:|.:|:|...:...||.|..::.
 Frog   172 IPQMTAGKCIGAIAMTEPGAGSDLQGVRTNAKKDGSDWILNGSKVFITNGWMSDVVIVVAVTNRE 236

  Fly   207 MK---HKGITAFLTPKDVPGLSIAKKESKMGMRATSTCQLVLEDVHVPRSRVLGAAGDGFKIAMQ 268
            .:   | ||:.||......|....:|..|:|::|..|.:|..|||.:|...:||....||...|.
 Frog   237 ARTPAH-GISLFLVDNGTKGFVKGRKLEKIGLKAQDTAELFFEDVRLPADALLGQENKGFYYLMA 300

  Fly   269 SLDCGRIGIAAQATGIAQAALELAVDYSQKRVAFGKHLARLQLIQQKLADMATRVEISRLLTWRA 333
            .|...|:.||..|....:...|...:|.::|.||||.:|.||.:|.|||::.|::.|.|...   
 Frog   301 ELPQERLLIADMALASCEFMFEETRNYVKQRKAFGKTIAHLQTVQHKLAELKTQICIGRTFL--- 362

  Fly   334 AWLKDNGLPITKE-------AAMAKLHASESATFCAHQCIQILGGMGYTTDLPAELYYRNARVTE 391
                ||.|.:..|       |:|||..||:.....|.||:|:.||.||..:.|....|.::||..
 Frog   363 ----DNCLQLHAEKRLDSATASMAKYWASDLQNSVATQCVQLHGGWGYMWEYPIAKAYVDSRVQP 423

  Fly   392 IYEGTSEIQRIVIANAVLRE 411
            ||.||:||.:.:||..:::|
 Frog   424 IYGGTNEIMKELIARDIVKE 443

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4860NP_650163.2 CaiA 37..414 CDD:224871 127/400 (32%)
SCAD_SBCAD 39..410 CDD:173847 125/395 (32%)
acadlNP_001039250.1 LCAD 70..441 CDD:173849 125/393 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D589058at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.