DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4860 and ACOXL

DIOPT Version :9

Sequence 1:NP_650163.2 Gene:CG4860 / 41480 FlyBaseID:FBgn0037999 Length:415 Species:Drosophila melanogaster
Sequence 2:XP_011509706.1 Gene:ACOXL / 55289 HGNCID:25621 Length:610 Species:Homo sapiens


Alignment Length:363 Identity:80/363 - (22%)
Similarity:149/363 - (41%) Gaps:47/363 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    99 QAYAIGMEEVARGDAAVSIVMGVNN-LYLGAVQQHGTEQQKQDFLVPYTQGEHIAFYALSEPGNG 162
            ::..|| |.::..|.|..:..|:.. |:.||::..|:.:....:..|..:.::...:|::|.|:|
Human    35 RSLVIG-EVLSMADMATGVKCGIIYWLFGGAIRNLGSPEHVTKWFQPLQEQKYTGMFAMTERGHG 98

  Fly   163 SDAGAAST--TAKLQGDSYQI-----NGTKAWISNSKEASGGIVFATVDKSMKHKGITAFLTP-K 219
            |:|....|  |..|....:.|     |..|.:|.|:...:...|||.:....:.:|...|:.| :
Human    99 SNARGIQTEATFDLSAQEFVIDTPCENAEKMYIGNAMYGNYAAVFAQLIIDGRSQGPHCFIVPVR 163

  Fly   220 D-----VPGLSIAKKESKMGMRATSTCQLVLEDVHVPRSRVL----GAAGDG------------F 263
            |     .||::......|.|:.......|:.:.|.:||..:|    ..|.||            |
Human   164 DENGSLYPGVTAIDMMYKEGLHGVDNGILIFDKVRIPRENLLDKFGSVAPDGQYHSPIRNKSARF 228

  Fly   264 KIAMQSLDCGRIGIAAQATGIAQAALELAVDYSQKRVAFG-KHLARLQLIQQK------LADMAT 321
            ...:.:|...|:.:|.||.|..:..|.:|:.||..|..|| |....:::|:.:      :..:||
Human   229 NAMLAALTPSRLAVAFQAMGAMKLGLTIAIRYSHSRRQFGPKTKEEVKIIEHQTQTLRLMPHLAT 293

  Fly   322 RVEISRLLTWRAAWLKD---------NGLPITKEAAMAKLHASESATFCAHQCIQILGGMGYTTD 377
            .:.::.:..:..|.|.:         |...:....|..|.:::.....|...|.:..|||||..:
Human   294 ALALTFVSRYAGALLDEDVFQGKELVNSRSLQALVAGLKAYSTWENIRCLQDCRECTGGMGYMME 358

  Fly   378 LPAELYYRNARVTEIYEGTSEIQRIVIANAVLRELGKE 415
            ........:..|...:||...:...|:...:|.:..|:
Human   359 NRISGLKCDTDVFATFEGDDVVMLQVVGRELLAQYTKQ 396

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4860NP_650163.2 CaiA 37..414 CDD:224871 79/360 (22%)
SCAD_SBCAD 39..410 CDD:173847 78/356 (22%)
ACOXLXP_011509706.1 ACAD 2..575 CDD:299127 80/363 (22%)
PLN02636 34..575 CDD:215342 80/363 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1960
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.