DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4860 and Acox1

DIOPT Version :9

Sequence 1:NP_650163.2 Gene:CG4860 / 41480 FlyBaseID:FBgn0037999 Length:415 Species:Drosophila melanogaster
Sequence 2:NP_059036.1 Gene:Acox1 / 50681 RGDID:619757 Length:661 Species:Rattus norvegicus


Alignment Length:431 Identity:94/431 - (21%)
Similarity:165/431 - (38%) Gaps:96/431 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 REFANAEL-APKARHHDREELYPAEQVRRLGELGLMSVTVREEYGGSGLD-----YQAYAIGMEE 107
            ||..|..| .|..:|.|...|..:::.....:.....|....|||.|..:     .:.|.....|
  Rat    34 REIENLILNDPDFQHEDYNFLTRSQRYEVAVKKSATMVKKMREYGISDPEEIMWFKKLYLANFVE 98

  Fly   108 VARGDAAVSIVMGVN-NLYLGAVQQHGTEQQKQDFLVPYTQGEHIAFYALSEPGNGSDAGAASTT 171
                      .:|:| ::::..:...||..|::.::.|..:.:.|..||.:|.|:|:......||
  Rat    99 ----------PVGLNYSMFIPTLLNQGTTAQQEKWMRPSQELQIIGTYAQTEMGHGTHLRGLETT 153

  Fly   172 A----KLQG---DSYQINGTKAWISN-SKEASGGIVFATVDKSMKHKGITAFLTP-------KDV 221
            |    |.|.   :|..:...|.|... .|.::..||.|.:....:..|:.||:.|       |.:
  Rat   154 ATYDPKTQEFILNSPTVTSIKWWPGGLGKTSNHAIVLAQLITQGECYGLHAFVVPIREIGTHKPL 218

  Fly   222 PGLSIAKKESKMGMRATSTCQLVLEDVHVPRSRVL----GAAGDG--FKIAMQSLDCGR------ 274
            ||:::.....|.|........|.:::..:||..:|    ....||  .|.....|..|.      
  Rat   219 PGITVGDIGPKFGYEEMDNGYLKMDNYRIPRENMLMKYAQVKPDGTYVKPLSNKLTYGTMVFVRS 283

  Fly   275 --IGIAAQATGIAQAALELAVDYSQKRVAFGKHLARLQLIQQ-----KLADMAT-RVEISRLLTW 331
              :|.|||:   ...|..:|:.||..|        |...|:|     ::.|..| :.::..||..
  Rat   284 FLVGNAAQS---LSKACTIAIRYSAVR--------RQSEIKQSEPEPQILDFQTQQYKLFPLLAT 337

  Fly   332 RAA------WLKDNGLPITKE------AAMAKLHASES-----ATFCAH----QCIQILGGMGY- 374
            ..|      ::|:..|.|.:.      :.:.:|||..:     .|:.|:    :|....||.|| 
  Rat   338 AYAFHFVGRYMKETYLRINESIGQGDLSELPELHALTAGLKAFTTWTANAGIEECRMACGGHGYS 402

  Fly   375 -TTDLPAELYYRNARVTE----IYEGTSEIQRIVIANAVLR 410
             ::.:|      |..||.    .:||.:.:..:..|..:::
  Rat   403 HSSGIP------NIYVTFTPACTFEGENTVMMLQTARFLMK 437

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4860NP_650163.2 CaiA 37..414 CDD:224871 94/431 (22%)
SCAD_SBCAD 39..410 CDD:173847 94/429 (22%)
Acox1NP_059036.1 AXO 3..638 CDD:173839 94/431 (22%)
Microbody targeting signal 659..661
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1960
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.