DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4860 and acox1

DIOPT Version :9

Sequence 1:NP_650163.2 Gene:CG4860 / 41480 FlyBaseID:FBgn0037999 Length:415 Species:Drosophila melanogaster
Sequence 2:NP_001005933.1 Gene:acox1 / 449662 ZFINID:ZDB-GENE-041010-219 Length:660 Species:Danio rerio


Alignment Length:412 Identity:97/412 - (23%)
Similarity:170/412 - (41%) Gaps:77/412 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 PKARHHD-----REELYPAEQVRRLGELGLMSVTVREEYGGSGLDYQAYAIGMEEVARGDAAVSI 117
            |..:|.|     |.|.|.| .||:..::    :....|||.|..: :.|:  .:.|.||  ....
Zfish    44 PDFQHEDLNFLSRSERYDA-AVRKSAQM----ILKLREYGISDPE-EIYS--YKTVVRG--VFQE 98

  Fly   118 VMGVNN-LYLGAVQQHGTEQQKQDFLVPYTQGEH-IAFYALSEPGNGSDAGAASTTAKLQGDSYQ 180
            .:||:| :::..::...|.:|::.: :|..:..| :..||.:|.|:|:...|..|||.....:.:
Zfish    99 PLGVHNVMFIPTLKSQCTAEQRKKW-IPLAESFHMLGTYAQTELGHGTHIRALETTATYDPSTQE 162

  Fly   181 INGTKAWISNSKEASGG--------IVFATVDKSMKHKGITAFLTP-------KDVPGLSIAKKE 230
            .....:.||:.|...||        ||.|.:....|..|:.||:||       ..:||:.:....
Zfish   163 FVLNSSTISSIKWWPGGLGKTSNHAIVLAQLYTQGKCHGLHAFITPIRCMKTHMPLPGVVVGDIG 227

  Fly   231 SKMGMRATSTCQLVLEDVHVPRSRVL----GAAGDG--FKIAMQSLDCG-RIGIAAQATGIAQAA 288
            .|.|........|.||:|.:||..:|    ....||  .|.....|..| .:.|.:...|.:..|
Zfish   228 PKFGFDEVDNGYLKLENVRIPRENMLMKYAQVEPDGTYVKPPSDKLTYGTMVFIRSMIVGESARA 292

  Fly   289 LE----LAVDYSQKRVAFGKHLARLQ--LIQQKLADMAT-RVEISRLLTWRAA-----------W 335
            |.    :|:.||..|     |.:.|:  ..:.::.|..| :.::..||....|           :
Zfish   293 LSKSCTIAIRYSAVR-----HQSELRPGEPEPQILDYQTQQYKLFPLLATAYAFHFVGQYMNKTY 352

  Fly   336 LKDNG-LPITKEAAMAKLHASES-----ATFCAHQCIQI----LGGMGYT--TDLPAELYYRNAR 388
            .:.:| :.:...:.:.:|||..:     .|:.|:..|::    .||.||:  :.||.  .|....
Zfish   353 HRISGDISLGDFSELPELHALSAGLKAFTTWAANTGIEVCRMSCGGHGYSRCSSLPD--IYVTFT 415

  Fly   389 VTEIYEGTSEIQRIVIANAVLR 410
            .|..|||.:.:..:..|..:::
Zfish   416 PTCTYEGENTVMMLQTARYLVK 437

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4860NP_650163.2 CaiA 37..414 CDD:224871 97/412 (24%)
SCAD_SBCAD 39..410 CDD:173847 97/410 (24%)
acox1NP_001005933.1 AXO 3..637 CDD:173839 97/412 (24%)
PLN02443 5..656 CDD:178062 97/412 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1960
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.