DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4860 and acadm

DIOPT Version :9

Sequence 1:NP_650163.2 Gene:CG4860 / 41480 FlyBaseID:FBgn0037999 Length:415 Species:Drosophila melanogaster
Sequence 2:NP_998175.2 Gene:acadm / 406283 ZFINID:ZDB-GENE-040426-1945 Length:426 Species:Danio rerio


Alignment Length:412 Identity:156/412 - (37%)
Similarity:225/412 - (54%) Gaps:6/412 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MQQLIRVARTLGQRSSGAWSARIIAGGNRGIACLAALSETHQILQKTCREFANAELAPKARHHDR 65
            :|..:|...|..|.|:.|.:|. :.|||.|.:  ..|:|..:..|:..|:||..|:.|.|..:||
Zfish    13 VQAGLRFQGTSAQASAKAATAS-LKGGNGGFS--FELTEQQKEFQEVARKFAREEIVPAAPSYDR 74

  Fly    66 EELYPAEQVRRLGELGLMSVTVREEYGGSGLDYQAYAIGMEEVARGDAAVSIVMGVNNLYLGAVQ 130
            ...||...::|..|||||:..:.|:.||.||......:..||:|.|...|...:..|:|....|.
Zfish    75 SGEYPFPLIKRAWELGLMNGHIPEDCGGMGLGIFDACLITEELAYGCTGVQTAIEANSLGQMPVI 139

  Fly   131 QHGTEQQKQDFLVPYTQGEHIAFYALSEPGNGSDAGAASTTAKLQGDSYQINGTKAWISNSKEAS 195
            ..|.:.|::.:|...|:...:..|.::|||.|||.....|.|..:||.|.|||.|.||:|..:|:
Zfish   140 IAGNDAQRKKYLGRMTEEPLMCAYCVTEPGAGSDVAGIKTRAVKKGDDYVINGQKMWITNGGKAN 204

  Fly   196 GGIVFATVDKSMK---HKGITAFLTPKDVPGLSIAKKESKMGMRATSTCQLVLEDVHVPRSRVLG 257
            ...:.|..|...|   .|..|.|:...|.||:...:||..||.|.:.|..:..|||.:|:..||.
Zfish   205 WYFLLARTDSDPKCPASKAFTGFIVDADTPGVQPGRKELNMGQRCSDTRGITFEDVVIPKENVLI 269

  Fly   258 AAGDGFKIAMQSLDCGRIGIAAQATGIAQAALELAVDYSQKRVAFGKHLARLQLIQQKLADMATR 322
            ..|.||||||.:.|..|..:||.|||:||.|||.|..|:.:|..|||.:|..|.:...||:||.:
Zfish   270 GEGAGFKIAMGAFDKTRPPVAAGATGLAQRALEEATKYAMERKTFGKFIAEHQAVSFLLAEMAMK 334

  Fly   323 VEISRLLTWRAAWLKDNGLPITKEAAMAKLHASESATFCAHQCIQILGGMGYTTDLPAELYYRNA 387
            ||::|:...||||..|.|...|..|::||..|.:.|..||...:||.||.|:.::.|.|...|:|
Zfish   335 VELARMAYQRAAWEVDMGRRNTYYASIAKAFAGDIANQCASDAVQIFGGNGFNSEYPVEKLMRDA 399

  Fly   388 RVTEIYEGTSEIQRIVIANAVL 409
            ::.:|||||::|||::|:..||
Zfish   400 KIYQIYEGTAQIQRLIISREVL 421

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4860NP_650163.2 CaiA 37..414 CDD:224871 145/376 (39%)
SCAD_SBCAD 39..410 CDD:173847 144/374 (39%)
acadmNP_998175.2 CaiA 44..426 CDD:224871 145/378 (38%)
MCAD 46..423 CDD:173846 145/376 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1960
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D589058at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.