DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4860 and CG6638

DIOPT Version :9

Sequence 1:NP_650163.2 Gene:CG4860 / 41480 FlyBaseID:FBgn0037999 Length:415 Species:Drosophila melanogaster
Sequence 2:NP_648239.1 Gene:CG6638 / 38979 FlyBaseID:FBgn0035911 Length:420 Species:Drosophila melanogaster


Alignment Length:387 Identity:144/387 - (37%)
Similarity:213/387 - (55%) Gaps:15/387 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 LSETHQILQKTCREFANAELAPKARHHDR----EELYPAEQVRRLGELGLMSVTVREEYGGSGLD 97
            |.|..|.|::....|...||||.|:..|:    :::.|.  .::||.||.:.:|...::||:|..
  Fly    39 LDEDRQKLREVAFNFFQKELAPLAKEIDKLDNFKDMRPF--WKKLGALGFLGITAEPDFGGTGGS 101

  Fly    98 YQAYAIGMEEVARGDAAVSIVMGV-NNLYLGAVQQHGTEQQKQDFLVPYTQGEHIAFYALSEPGN 161
            |..:.|.|||.:|....|::..|. :||.:..:.::||.:||:.:|.....|||:...|:||||.
  Fly   102 YLDHCIIMEEFSRAAGGVALSYGAHSNLCINQLTKNGTPEQKEKYLPKLCSGEHVGGLAMSEPGA 166

  Fly   162 GSDAGAASTTAKLQGDSYQINGTKAWISNSKEASGGIVFATVDKS---MKHKGITAFLTPKDVPG 223
            |||..:....|:.:||.|.:||:|.||:|..:|...||:|....|   .|| |||||:......|
  Fly   167 GSDVVSMKLRAERKGDYYVLNGSKFWITNGSDADTLIVYAKTGGSGVPDKH-GITAFIVETAWEG 230

  Fly   224 LSIAKKESKMGMRATSTCQLVLEDVHVPRSRVLGAAGDGFKIAMQSLDCGRIGIAAQATGIAQAA 288
            .|:|:|..|:|||.:|||:||.:|:.||...:||....|..:.|..||..|:.:||...|:.|||
  Fly   231 FSVAQKLDKLGMRGSSTCELVFQDLKVPAKNILGQENRGVYVLMSGLDFERLVLAAGPVGLMQAA 295

  Fly   289 LELAVDYSQKRVAFGKHLARLQLIQQKLADMATRVEISRLLTWRAAWLKDNGLPITKEAAMAKLH 353
            .::|.||:.:|....|.:...||:|.|:|||.|.:...|...:..|...|.|....|:.|...|:
  Fly   296 CDVAFDYAHQRKQMNKLIGEFQLLQGKMADMYTTLSACRSYLYTVARSCDAGNRSPKDCAGVILY 360

  Fly   354 ASESATFCAHQCIQILGGMGYTTDLPAELYYRNARVTEIYEGTSEIQRIVIANAVLRELGKE 415
            .:|.||..|...||||||.||..:.|.....|:|::.||..|||||:|.:|.    |:|.:|
  Fly   361 TAEKATKVALDAIQILGGNGYINENPTGRILRDAKLYEIGAGTSEIRRWLIG----RQLNQE 418

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4860NP_650163.2 CaiA 37..414 CDD:224871 143/384 (37%)
SCAD_SBCAD 39..410 CDD:173847 140/378 (37%)
CG6638NP_648239.1 PLN02519 14..418 CDD:215284 143/385 (37%)
IVD 38..417 CDD:173845 143/384 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460746
Domainoid 1 1.000 70 1.000 Domainoid score I509
eggNOG 1 0.900 - - E1_COG1960
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 183 1.000 Inparanoid score I179
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D589058at2759
OrthoFinder 1 1.000 - - FOG0000508
OrthoInspector 1 1.000 - - mtm9754
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR43884
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
98.900

Return to query results.
Submit another query.