DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4860 and Mcad

DIOPT Version :9

Sequence 1:NP_650163.2 Gene:CG4860 / 41480 FlyBaseID:FBgn0037999 Length:415 Species:Drosophila melanogaster
Sequence 2:NP_648149.1 Gene:Mcad / 38864 FlyBaseID:FBgn0035811 Length:419 Species:Drosophila melanogaster


Alignment Length:374 Identity:142/374 - (37%)
Similarity:207/374 - (55%) Gaps:5/374 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 ALSETHQILQKTCREFANAELAPKARHHDREELYPAEQVRRLGELGLMSVTVREEYGGSGLDYQA 100
            ||:|....||:..|:|...|:.|.|..:|:...||...:::..|||||:..:..:.||..||...
  Fly    36 ALTEDQLQLQELARKFTREEIIPVAAQYDKSGEYPWPIIKKAWELGLMNNHIPADIGGLDLDVFT 100

  Fly   101 YAIGMEEVARGDAAVSIVMGVNNLYLGAVQQHGTEQQKQDFLVPYTQGEHIAFYALSEPGNGSDA 165
            ..:..||:|.|...:...:..:.|....|...|.::||:.:|....:...:|.|.::|||.|||.
  Fly   101 TCLSAEELAYGCTGIMTALEASGLGQTPVILSGNKEQKKKYLGRLLEEPLVAAYCVTEPGAGSDV 165

  Fly   166 GAASTTAKLQGDSYQINGTKAWISNSKEASGGIVFATVDKSMK---HKGITAFLTPKDVPGLSIA 227
            ....|.|:.:||.:.|||.|.||:|...|:...|.|..:...|   .|..|.|:..:|.|||:..
  Fly   166 SGIKTRAEKKGDEWVINGQKMWITNGGVANWYFVLARTNPDPKCPPSKAFTGFIVERDSPGLTPG 230

  Fly   228 KKESKMGMRATSTCQLVLEDVHVPRSRVLGAAGDGFKIAMQSLDCGRIGIAAQATGIAQAALELA 292
            :||..||.||:.|..:..|||.||:..||...|.||||||.:.|..|..:||.|.|:||..|:.|
  Fly   231 RKELNMGQRASDTRGITFEDVRVPKENVLIGEGAGFKIAMGTFDKTRPPVAAGAVGLAQRCLDEA 295

  Fly   293 VDYSQKRVAFGKHLARLQLIQQKLADMATRVEISRLLTWR-AAWLKDNGLPITKEAAMAKLHASE 356
            :.|:.:|..||..:|..|.:|..|||||..||.|| |.|| :||..|.|...:..|::||.||::
  Fly   296 LKYALERKTFGVPIAYHQAVQFMLADMAIGVETSR-LAWRLSAWEIDQGRRNSYYASIAKCHAAD 359

  Fly   357 SATFCAHQCIQILGGMGYTTDLPAELYYRNARVTEIYEGTSEIQRIVIA 405
            .|...|...:||.||.|:.::.|.|...|:|::.:||||||:|||::|:
  Fly   360 MANKIASDAVQIFGGNGFNSEYPVEKLMRDAKIYQIYEGTSQIQRLIIS 408

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4860NP_650163.2 CaiA 37..414 CDD:224871 141/373 (38%)
SCAD_SBCAD 39..410 CDD:173847 140/371 (38%)
McadNP_648149.1 CaiA 35..411 CDD:224871 142/374 (38%)
MCAD 37..414 CDD:173846 141/373 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460768
Domainoid 1 1.000 97 1.000 Domainoid score I372
eggNOG 1 0.900 - - E1_COG1960
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 183 1.000 Inparanoid score I179
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D589058at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm9754
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.800

Return to query results.
Submit another query.