DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4860 and ACADVL

DIOPT Version :10

Sequence 1:NP_650163.2 Gene:CG4860 / 41480 FlyBaseID:FBgn0037999 Length:415 Species:Drosophila melanogaster
Sequence 2:NP_001257376.1 Gene:ACADVL / 37 HGNCID:92 Length:678 Species:Homo sapiens


Alignment Length:56 Identity:12/56 - (21%)
Similarity:23/56 - (41%) Gaps:12/56 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 FEDFQEKTVFDWKSEFNLKNAKKVERWTVEEKEKREKQRCFIEVEHYKKKEYLNFL 78
            ||:.::....|.:|:      |..|.|..:.:|:      .|..|.:..:.:..||
Human   248 FEEEEDSDEEDQRSD------KDSEAWVPDSEER------LILREEFTSRMHQRFL 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4860NP_650163.2 SCAD_SBCAD 39..410 CDD:173847 8/40 (20%)
ACADVLNP_001257376.1 VLCAD 95..504 CDD:173850 12/56 (21%)

Return to query results.
Submit another query.