DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4860 and Egm

DIOPT Version :9

Sequence 1:NP_650163.2 Gene:CG4860 / 41480 FlyBaseID:FBgn0037999 Length:415 Species:Drosophila melanogaster
Sequence 2:NP_610687.1 Gene:Egm / 36242 FlyBaseID:FBgn0086712 Length:639 Species:Drosophila melanogaster


Alignment Length:365 Identity:84/365 - (23%)
Similarity:150/365 - (41%) Gaps:43/365 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 LQKTCREFANAELAPKARHHDREELYPAEQVRRLGELGLMSVTVREEYGGSGLDYQAYAIGMEEV 108
            |:.:.....|..:.|:    :.||..| |.:|:||..||   .|..:|.|.|..:.|..:..|..
  Fly    97 LENSLLPLKNYFVEPR----ETEETSP-ETLRQLGLYGL---NVSTDYEGKGYGWSASLMASEPD 153

  Fly   109 ARGDAAVSIVMGVNNLYLGAVQQHGTEQQKQDFLVPYTQGEHI---AFYALSEPGNGSDAGAAST 170
            :. |..|::.:..:.:.:..:::.||..|:|.:|.....|:.|   |.|.:|.|    :....:|
  Fly   154 ST-DINVTLGLQTHRVVVDLLKEVGTPLQQQRYLQDLATGKLIGTEAIYEISPP----EEDYFNT 213

  Fly   171 TAKL--QGDSYQINGTKAW-ISNSKEASGGIVFATVDK----SMKHKGITAFLTPKDVPGLSIAK 228
            ||:|  :...:|:||.|:: |....|....:|.|...:    .:..:|.|.||......|:.:.:
  Fly   214 TAELFPEYGKWQLNGEKSFVICTPGERQLFLVLAQTQQPNVPGVLGRGTTIFLVDSQQEGVRLGE 278

  Fly   229 KESKMGMRATSTCQLVLEDVHVPRSRVLGAAGDGFKIAMQSLDCGRIGIAAQATGIAQAALELAV 293
            |.:..|.|.....::..|.|.:...:|:|...||.:.:.|.:...|:..:.....:|:..|....
  Fly   279 KHATFGCRKAEIRRVHFEGVKLGEDQVVGLPHDGNRYSEQLVRSSRLRGSLVGLSLAKKLLNELA 343

  Fly   294 DYSQKRVAFGKHLARLQLIQQKLADMATRVEISRL---------LTWRAAWLKD--NGLPITKEA 347
            .|:......|..|..|:|         ||:.:||.         :.:..|.|.|  ....:|.|:
  Fly   344 QYTVNTTQCGVQLQDLEL---------TRIHMSRAMCSVYAMESMLYLTAGLLDEFRAQDVTLES 399

  Fly   348 AMAKLHASESATFCAHQCIQILGGMGYTTDLPAELYYRNA 387
            |:.|..........|.|.:.::|.....:....||..|:|
  Fly   400 AITKYFTLRQVYAIASQNLGVVGPKSLLSGETTELGLRDA 439

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4860NP_650163.2 CaiA 37..414 CDD:224871 84/365 (23%)
SCAD_SBCAD 39..410 CDD:173847 84/365 (23%)
EgmNP_610687.1 ACAD 92..457 CDD:173838 84/365 (23%)
CaiA 122..439 CDD:224871 76/333 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1960
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.