DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4860 and CG17544

DIOPT Version :9

Sequence 1:NP_650163.2 Gene:CG4860 / 41480 FlyBaseID:FBgn0037999 Length:415 Species:Drosophila melanogaster
Sequence 2:NP_001163015.1 Gene:CG17544 / 35213 FlyBaseID:FBgn0032775 Length:693 Species:Drosophila melanogaster


Alignment Length:477 Identity:107/477 - (22%)
Similarity:180/477 - (37%) Gaps:107/477 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 QRSSGAWS-ARIIAGGNRGIACLAALSETHQILQKTCREFANAEL---APKARHHDREELYPAEQ 73
            :|::..|. .|:|....:|:          :|..|..|...|..|   ..:....|.::...|.|
  Fly    23 KRANFDWKRLRLIFEKEQGL----------RIKYKVWRRLENDPLFAHPSRTLPMDEQKRLCAMQ 77

  Fly    74 VRRLGELGLMSVTVREEYGGSGLDYQAYAIGMEEVARGDAAVSIVMGVNNLYLGAVQQHGTEQQK 138
            |.|:..|.|:...:......:...|..|............:|.|.:|| .|:..|::..|||:. 
  Fly    78 VNRMKHLDLVPKEIESLSFSAKTKYLMYINEALACYSPSLSVKIALGV-GLFNNAIRAMGTEKH- 140

  Fly   139 QDFLVPYTQGEHIAFYALSEPGNGSDAGAASTTAKLQ--GDSYQIN-----GTKAWISN-SKEAS 195
            |.::......|.|...|::|..:||:..:..|||...  ...:.||     ..|.|:.| .|.|:
  Fly   141 QKYIEAAWNREVITCLAITELSHGSNTKSIRTTATYDPTTQEFVINTPDFEAAKCWVGNLGKTAT 205

  Fly   196 GGIVFA---TVDKSMKHKGITAFLTP-KD------VPGLSIAKKESKMGMRATSTCQLVLEDVHV 250
            ..:.||   |.|.  ::.|:..||.| :|      .||:.:.....|.|:.......:|..:..:
  Fly   206 VAMTFANLYTADG--QNHGLHGFLIPIRDPKTLLSYPGVLVGDIGEKCGLNGIDNGFVVFTNYRI 268

  Fly   251 PRSRVLGAAGD----------------GFKIAMQSLDCGRIGIAAQATGIAQAALELAVDYSQKR 299
            ||..:|....|                ....|::|...|||||..::.....:|..:||.||..|
  Fly   269 PRDNLLNRTSDVTPEGVYESVFTEPGKVLGAALESFSAGRIGIMQESANTLCSAAVIAVRYSAVR 333

  Fly   300 VAFG--KHLARLQLIQ-----------------QKLAD---MATRVEISRLLTWRAAWLKDNGLP 342
            ..||  :|...:.:::                 ||:|.   .:|.:||.     ..:....||..
  Fly   334 KQFGPERHGEEMAILEYQLHQYRIFPYLAAACVQKIATEELTSTYMEII-----ARSQADSNGFD 393

  Fly   343 ITKEAAMAKLHASESA-----TFCAHQCIQ----ILGGMGYTTDLPAELYYRNARVTEI------ 392
            :..:.| |::||..|:     |:.|...||    ..||.|         |.:.|::.::      
  Fly   394 VLTQNA-AEIHALISSSKPLITWAARDAIQEAREACGGHG---------YLQAAKLGQMRTDHDP 448

  Fly   393 ---YEGTSEIQRIVIANAVLRE 411
               |||.:.:.....:|.:||:
  Fly   449 LCTYEGDNNVLGQQASNWLLRQ 470

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4860NP_650163.2 CaiA 37..414 CDD:224871 102/452 (23%)
SCAD_SBCAD 39..410 CDD:173847 100/447 (22%)
CG17544NP_001163015.1 AXO 16..670 CDD:173839 107/477 (22%)
PLN02443 18..687 CDD:178062 107/477 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1960
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.