DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4860 and ACADM

DIOPT Version :9

Sequence 1:NP_650163.2 Gene:CG4860 / 41480 FlyBaseID:FBgn0037999 Length:415 Species:Drosophila melanogaster
Sequence 2:NP_001272972.1 Gene:ACADM / 34 HGNCID:89 Length:454 Species:Homo sapiens


Alignment Length:439 Identity:154/439 - (35%)
Similarity:221/439 - (50%) Gaps:39/439 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 RVARTLGQRSSGAWSARIIAGGNR---GIACLAALSETHQILQKTCREFANAELAPKARHHDREE 67
            |..|.|...|...|.::......:   |:......:|..:..|.|.|:||..|:.|.|..:|:..
Human     7 RCCRVLRSISRFHWRSQHTKANRQREPGLGFSFEFTEQQKEFQATARKFAREEIIPVAAEYDKTG 71

  Fly    68 LYPAEQVRRLGELGLMSVTVRE--EY-------------------------------GGSGLDYQ 99
            .||...:||..|||||:..:.|  :|                               ||.||...
Human    72 EYPVPLIRRAWELGLMNTHIPENCDYSVCPLLEACTLYLDAFFLLLTGSNLNLHLNLGGLGLGTF 136

  Fly   100 AYAIGMEEVARGDAAVSIVMGVNNLYLGAVQQHGTEQQKQDFLVPYTQGEHIAFYALSEPGNGSD 164
            ...:..||:|.|...|...:..|:|....:...|.:|||:.:|...|:...:..|.::|||.|||
Human   137 DACLISEELAYGCTGVQTAIEGNSLGQMPIIIAGNDQQKKKYLGRMTEEPLMCAYCVTEPGAGSD 201

  Fly   165 AGAASTTAKLQGDSYQINGTKAWISNSKEASGGIVFATVD---KSMKHKGITAFLTPKDVPGLSI 226
            .....|.|:.:||.|.|||.|.||:|..:|:...:.|..|   |:..:|..|.|:...|.||:.|
Human   202 VAGIKTKAEKKGDEYIINGQKMWITNGGKANWYFLLARSDPDPKAPANKAFTGFIVEADTPGIQI 266

  Fly   227 AKKESKMGMRATSTCQLVLEDVHVPRSRVLGAAGDGFKIAMQSLDCGRIGIAAQATGIAQAALEL 291
            .:||..||.|.:.|..:|.|||.||:..||...|.|||:||.:.|..|..:||.|.|:||.||:.
Human   267 GRKELNMGQRCSDTRGIVFEDVKVPKENVLIGDGAGFKVAMGAFDKTRPVVAAGAVGLAQRALDE 331

  Fly   292 AVDYSQKRVAFGKHLARLQLIQQKLADMATRVEISRLLTWRAAWLKDNGLPITKEAAMAKLHASE 356
            |..|:.:|..|||.|...|.|...||:||.:||::|:...||||..|:|...|..|::||..|.:
Human   332 ATKYALERKTFGKLLVEHQAISFMLAEMAMKVELARMSYQRAAWEVDSGRRNTYYASIAKAFAGD 396

  Fly   357 SATFCAHQCIQILGGMGYTTDLPAELYYRNARVTEIYEGTSEIQRIVIA 405
            .|...|...:|||||.|:.|:.|.|...|:|::.:||||||:|||:::|
Human   397 IANQLATDAVQILGGNGFNTEYPVEKLMRDAKIYQIYEGTSQIQRLIVA 445

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4860NP_650163.2 CaiA 37..414 CDD:224871 148/405 (37%)
SCAD_SBCAD 39..410 CDD:173847 148/403 (37%)
ACADMNP_001272972.1 CaiA 39..453 CDD:224871 148/407 (36%)
MCAD 41..451 CDD:173846 148/405 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1960
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D589058at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.