DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4860 and CG9547

DIOPT Version :9

Sequence 1:NP_650163.2 Gene:CG4860 / 41480 FlyBaseID:FBgn0037999 Length:415 Species:Drosophila melanogaster
Sequence 2:NP_609040.1 Gene:CG9547 / 33911 FlyBaseID:FBgn0031824 Length:419 Species:Drosophila melanogaster


Alignment Length:377 Identity:112/377 - (29%)
Similarity:187/377 - (49%) Gaps:11/377 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 LSETHQILQKTCREFANAELAPKARHHDREELYPAEQVRRLGELGLMSVTVREEYGGSGLDYQAY 101
            |:|....::...|.:..|||.|:.:..:|.|.:..:.:..:|.||::..|:: .||.:|:...||
  Fly    41 LTEEEVAIRDAFRGYCQAELQPRVKMANRLETFDKKIMEEIGSLGVLGCTIK-GYGCAGVSSVAY 104

  Fly   102 AIGMEEVARGDAAVSIVMGV-NNLYLGAVQQHGTEQQKQDFLVPYTQGEHIAFYALSEPGNGSDA 165
            .:...||.|.|:|....:.| ::|.:||:...|:|:|||.:|....:|:.|..:.|:||.:|||.
  Fly   105 GLLTREVERVDSAYRSAVSVQSSLAMGAIYDFGSEEQKQRYLPSMAEGKLIGAFGLTEPNHGSDP 169

  Fly   166 GAASTTAKLQGDS--YQINGTKAWISNSKEASGGIVFATVDKSMKHKGITAFLTPKDV--PGLSI 226
            ....|.||....|  |.:||:|.||:::..|...:|:|..:...    :..||..:.:  .||..
  Fly   170 AGMETRAKYDSKSKTYILNGSKTWITSAPIADVIVVWAKCEDGK----VRGFLVDRKISGKGLET 230

  Fly   227 AKKESKMGMRATSTCQLVLEDVHVPRSRVLGAAGDGFKIAMQSLDCGRIGIAAQATGIAQAALEL 291
            .|.|.|..:||:.|..:::::|.||..::|.... ||......|:..|.|||..|.|.|:..:|:
  Fly   231 PKIEGKFSLRASPTGMILMDEVRVPEEQLLPNVA-GFSGPFSCLNNARYGIAWGALGAAETCVEI 294

  Fly   292 AVDYSQKRVAFGKHLARLQLIQQKLADMATRVEISRLLTWRAAWLKDNGLPITKEAAMAKLHASE 356
            |..|:..|..||:.||..||||:||||..|.:.:..........|||..|......::.|.:.:.
  Fly   295 ARQYTLDRKQFGRPLAANQLIQKKLADAITEIALGLQACLHVGRLKDQKLHTPDMISLLKRNNTG 359

  Fly   357 SATFCAHQCIQILGGMGYTTDLPAELYYRNARVTEIYEGTSEIQRIVIANAV 408
            .:...|.|...:||..|.:.:.....:..|......||||.:|..:::..|:
  Fly   360 KSLDIARQMRDMLGANGISDEYHVIRHVINLESVNTYEGTHDIHALILGRAI 411

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4860NP_650163.2 CaiA 37..414 CDD:224871 112/377 (30%)
SCAD_SBCAD 39..410 CDD:173847 111/375 (30%)
CG9547NP_609040.1 GCD 29..417 CDD:173840 112/377 (30%)
CaiA 41..417 CDD:224871 112/377 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460766
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1960
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D589058at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.