DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4860 and Acoxl

DIOPT Version :9

Sequence 1:NP_650163.2 Gene:CG4860 / 41480 FlyBaseID:FBgn0037999 Length:415 Species:Drosophila melanogaster
Sequence 2:XP_017447070.1 Gene:Acoxl / 296138 RGDID:1306814 Length:656 Species:Rattus norvegicus


Alignment Length:366 Identity:85/366 - (23%)
Similarity:153/366 - (41%) Gaps:53/366 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    99 QAYAIGMEEVARGDAAVSIVMGVNNLYL---GAVQQHGTEQQKQDFLVPYTQGEHIAFYALSEPG 160
            |::.:| |.:...|.::||..||  ::|   |||...|:.:....:..|..:.::...:|::|.|
  Rat    85 QSFVLG-EVLCMVDVSMSIKCGV--IFLLFGGAVNNLGSPEHVIKWFRPLKEQKYTGMFAMTEKG 146

  Fly   161 NGSDAGAASTTAKLQGDSYQI-------NGTKAWISNSKEASGGIVFATVDKSMKHKGITAFLTP 218
            :||:.....|.|....||.:.       |..|.:|.|:...:...|||.:....|.:|...|:.|
  Rat   147 HGSNIRGIQTEATFDCDSQEFVIDMPCENAQKMYIGNAMHGNYAAVFAQLIIEGKSQGPHCFIVP 211

  Fly   219 -KD-----VPGLSIAKKESKMGMRATSTCQLVLEDVHVPRSRVLGAAG----DG----------- 262
             :|     .||::......|.|:.......|:.:.|.:||..:|...|    ||           
  Rat   212 IRDENGNLYPGVTAIDMMYKEGLNGVDNGILIFDKVRIPRENMLDKLGSVTPDGQYHSPIQSKSA 276

  Fly   263 -FKIAMQSLDCGRIGIAAQATGIAQAALELAVDYSQKRVAFG-KHLARLQLIQQK------LADM 319
             |...:..|...|:.:..||.|..:..|.:|:.||..|..|| |....:::|:.:      ::.:
  Rat   277 RFNAMLAILTPSRLAVTFQAMGAMKLGLMIAIRYSHSRRQFGPKGKEEVKIIEHQMQALRLMSHL 341

  Fly   320 ATRVEISRLLTWRAAWLKDNGLPITKE--------AAMA--KLHASESATFCAHQCIQILGGMGY 374
            ||.:.:: ..:..|..:.|..:...:|        |.||  |.:::.....|...|.:..|||||
  Rat   342 ATALALT-FTSRHAGHILDEDILQGRELINRRSLQALMAGLKAYSTWETVRCLQDCRECTGGMGY 405

  Fly   375 TTDLPAELYYRNARVTEIYEGTSEIQRIVIANAVLRELGKE 415
            ..:........:..|...:||.:.:...|:|..:|.:..|:
  Rat   406 MMENRLSGLKCDTDVFVTFEGDNVVMLQVVARELLAQYSKQ 446

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4860NP_650163.2 CaiA 37..414 CDD:224871 84/363 (23%)
SCAD_SBCAD 39..410 CDD:173847 83/359 (23%)
AcoxlXP_017447070.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1960
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.