DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4860 and ACAD8

DIOPT Version :9

Sequence 1:NP_650163.2 Gene:CG4860 / 41480 FlyBaseID:FBgn0037999 Length:415 Species:Drosophila melanogaster
Sequence 2:XP_024304205.1 Gene:ACAD8 / 27034 HGNCID:87 Length:493 Species:Homo sapiens


Alignment Length:356 Identity:121/356 - (33%)
Similarity:192/356 - (53%) Gaps:13/356 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 IIAGGNRGI-ACL---AALSETHQILQKTCREFANAELAPKARHHDREELYPAEQVRRLGELGLM 83
            ::..|:|.: :|:   ..|:|..:..||...:||..|:||.....|::||:|.:.:|:..:||..
Human    23 LVQTGHRSLTSCIDPSMGLNEEQKEFQKVAFDFAAREMAPNMAEWDQKELFPVDVMRKAAQLGFG 87

  Fly    84 SVTVREEYGGSGLDYQAYAIGMEEVARGDAAVSIVMGVNNLYLGAVQQHGTEQQKQDFLVPYTQG 148
            .|.::.:.|||||.....::..|.:|.|..:.:..:.::|:....:...|.|:|:..|..|....
Human    88 GVYIQTDVGGSGLSRLDTSVIFEALATGCTSTTAYISIHNMCAWMIDSFGNEEQRHKFCPPLCTM 152

  Fly   149 EHIAFYALSEPGNGSDAGAASTTAKLQGDSYQINGTKAWISNSKEASGGIVFATVDKSMKHKGIT 213
            |..|.|.|:|||:||||.:..|:||.|||.|.:||:||:||.:.|:...:|..... ....|||:
Human   153 EKFASYCLTEPGSGSDAASLLTSAKKQGDHYILNGSKAFISGAGESDIYVVMCRTG-GPGPKGIS 216

  Fly   214 AFLTPKDVPGLSIAKKESKMGMRATSTCQLVLEDVHVPRSRVLGAAGDGFKIAMQSLDCGRIGIA 278
            ..:..|..||||..|||.|:|..:..|..::.||..||.:..:|:.|.||.||::.|:.|||.||
Human   217 CIVVEKGTPGLSFGKKEKKVGWNSQPTRAVIFEDCAVPVANRIGSEGQGFLIAVRGLNGGRINIA 281

  Fly   279 AQATGIAQAALELAVDYSQKRVAFGKHLARLQLIQQKLADMATRVEISRLLTWRAA-WLKDNGLP 342
            :.:.|.|.|::.|..|:...|..||:.||..|.:|..|||||||:..:||:...|| .|::....
Human   282 SCSLGAAHASVILTRDHLNVRKQFGEPLASNQYLQFTLADMATRLVAARLMVRNAAVALQEERKD 346

  Fly   343 ITKEAAMAKLHASESATFCAHQCIQILGGMG 373
            .....:||||.|::       :|..:....|
Human   347 AVALCSMAKLFATD-------ECFAVSDSSG 370

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4860NP_650163.2 CaiA 37..414 CDD:224871 118/338 (35%)
SCAD_SBCAD 39..410 CDD:173847 117/336 (35%)
ACAD8XP_024304205.1 IBD 41..387 CDD:173851 118/338 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1960
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.